BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20021 (716 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A2ASU0 Cluster: Novel protein; n=23; Danio rerio|Rep: N... 37 0.43 UniRef50_A2AST9 Cluster: Novel protein; n=6; Danio rerio|Rep: No... 37 0.43 UniRef50_UPI0000F20ED8 Cluster: PREDICTED: hypothetical protein;... 35 2.3 UniRef50_UPI0000F20E85 Cluster: PREDICTED: hypothetical protein;... 34 3.0 UniRef50_UPI0000F20E5E Cluster: PREDICTED: hypothetical protein;... 34 3.0 UniRef50_Q6E263 Cluster: Cysteine-rich repeat secretory protein ... 34 3.0 UniRef50_UPI0000F21FF9 Cluster: PREDICTED: hypothetical protein;... 34 4.0 UniRef50_UPI0000F20EBE Cluster: PREDICTED: hypothetical protein;... 33 9.3 UniRef50_A4FXJ4 Cluster: Type I site-specific deoxyribonuclease,... 33 9.3 >UniRef50_A2ASU0 Cluster: Novel protein; n=23; Danio rerio|Rep: Novel protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 199 Score = 37.1 bits (82), Expect = 0.43 Identities = 21/73 (28%), Positives = 39/73 (53%), Gaps = 4/73 (5%) Frame = +2 Query: 221 GLN--IFIINISIQGSFRISYIVYNCALCPNCNVT*TFVCTLINVFVTSLSWL--HIVFS 388 G+N I ++S+ + + ++ + C + VC+++NV SLSW + V S Sbjct: 90 GINRTIKTFSVSVYARLPVPVLTFSSSQCSPSQYNCSVVCSVVNVSAVSLSWYKGNSVLS 149 Query: 389 TISVENLNSEISL 427 +ISV +L+ +SL Sbjct: 150 SISVSDLSISLSL 162 >UniRef50_A2AST9 Cluster: Novel protein; n=6; Danio rerio|Rep: Novel protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 190 Score = 37.1 bits (82), Expect = 0.43 Identities = 21/72 (29%), Positives = 38/72 (52%), Gaps = 2/72 (2%) Frame = +2 Query: 218 AGLNIFIINISIQGSFRISYIVYNCALCPNCNVT*TFVCTLINVFVTSLSWL--HIVFST 391 A L I ++S+ + ++ + + C + + VC+++NV SLSW + V S Sbjct: 91 AKLIIKTFSVSVYARLPVPVLICSSSQCSSSQYNCSVVCSVMNVSAVSLSWYKGNSVLSN 150 Query: 392 ISVENLNSEISL 427 ISV +L+ +SL Sbjct: 151 ISVSDLSISLSL 162 >UniRef50_UPI0000F20ED8 Cluster: PREDICTED: hypothetical protein; n=1; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 280 Score = 34.7 bits (76), Expect = 2.3 Identities = 17/35 (48%), Positives = 25/35 (71%), Gaps = 2/35 (5%) Frame = +2 Query: 329 VCTLINVFVTSLSWL--HIVFSTISVENLNSEISL 427 +C+++NV SLSW + + S+ISV NL+S ISL Sbjct: 141 LCSVVNVSAVSLSWYKGNSLLSSISVSNLSSSISL 175 >UniRef50_UPI0000F20E85 Cluster: PREDICTED: hypothetical protein; n=1; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 274 Score = 34.3 bits (75), Expect = 3.0 Identities = 17/35 (48%), Positives = 24/35 (68%), Gaps = 2/35 (5%) Frame = +2 Query: 329 VCTLINVFVTSLSWL--HIVFSTISVENLNSEISL 427 VC+++NV SLSW + V S+I+V +LN ISL Sbjct: 168 VCSVVNVRAVSLSWYKGNTVLSSINVSDLNKSISL 202 >UniRef50_UPI0000F20E5E Cluster: PREDICTED: hypothetical protein; n=2; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 370 Score = 34.3 bits (75), Expect = 3.0 Identities = 17/37 (45%), Positives = 25/37 (67%), Gaps = 2/37 (5%) Frame = +2 Query: 323 TFVCTLINVFVTSLSWL--HIVFSTISVENLNSEISL 427 + VC+++NV SLSW + V S ISV +L+S +SL Sbjct: 142 SLVCSVVNVSAVSLSWYKGNSVLSKISVSDLSSSVSL 178 >UniRef50_Q6E263 Cluster: Cysteine-rich repeat secretory protein 39 precursor; n=2; Arabidopsis thaliana|Rep: Cysteine-rich repeat secretory protein 39 precursor - Arabidopsis thaliana (Mouse-ear cress) Length = 319 Score = 34.3 bits (75), Expect = 3.0 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +2 Query: 590 CHIIWSFIKKDTQGGYLEQGHKYTALKLQKHGI 688 CH+I+ F + DT G + HKY + +HG+ Sbjct: 140 CHLIYKFERIDTPGAQVNNHHKYKLFETPEHGL 172 >UniRef50_UPI0000F21FF9 Cluster: PREDICTED: hypothetical protein; n=1; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 264 Score = 33.9 bits (74), Expect = 4.0 Identities = 17/36 (47%), Positives = 24/36 (66%), Gaps = 2/36 (5%) Frame = +2 Query: 326 FVCTLINVFVTSLSWL--HIVFSTISVENLNSEISL 427 F+C ++NV SLSW + V S+ISV NL+ +SL Sbjct: 146 FLCLVLNVSAVSLSWYKENSVLSSISVSNLSISLSL 181 >UniRef50_UPI0000F20EBE Cluster: PREDICTED: hypothetical protein; n=2; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 291 Score = 32.7 bits (71), Expect = 9.3 Identities = 22/65 (33%), Positives = 36/65 (55%), Gaps = 3/65 (4%) Frame = +2 Query: 242 NISIQGSFRISYIVYNCALCPN-CNVT*TFVCTLINVFVTSLSWL--HIVFSTISVENLN 412 NI++ I + +C+ C+V VC+++NV SLSW + V S+ISV +L+ Sbjct: 115 NITVYARLLIPVLKRDCSSSVQYCSV----VCSVVNVSAVSLSWYKGNSVLSSISVSDLS 170 Query: 413 SEISL 427 +SL Sbjct: 171 ISLSL 175 >UniRef50_A4FXJ4 Cluster: Type I site-specific deoxyribonuclease, HsdR family; n=3; cellular organisms|Rep: Type I site-specific deoxyribonuclease, HsdR family - Methanococcus maripaludis Length = 1024 Score = 32.7 bits (71), Expect = 9.3 Identities = 16/39 (41%), Positives = 25/39 (64%) Frame = -3 Query: 411 FKFSTEIVENTICSHDKDVTKTLIKVHTNVYVTLQLGHN 295 +KFS + +EN I D +T+ LIK + +VY L LG++ Sbjct: 66 YKFSEKSIENAIADLDVPLTEGLIKSNEHVYDQLILGNS 104 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 754,600,752 Number of Sequences: 1657284 Number of extensions: 15570666 Number of successful extensions: 30727 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 29761 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30719 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 57851245060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -