BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20021 (716 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y08569-1|CAA69880.1| 1015|Homo sapiens Islet Cell Autoantigen Re... 32 2.4 X62899-1|CAA44688.2| 591|Homo sapiens Islet Cell Antigen 512 pr... 32 2.4 U81561-1|AAB68603.1| 998|Homo sapiens protein tyrosine phosphat... 32 2.4 U66702-1|AAC50742.1| 1015|Homo sapiens phogrin protein. 32 2.4 U65065-1|AAC51643.1| 986|Homo sapiens tyrosine phosphatase IA-2... 32 2.4 L18983-1|AAA90974.1| 979|Homo sapiens tyrosine phosphatase prot... 32 2.4 BT006975-1|AAP35621.1| 591|Homo sapiens protein tyrosine phosph... 32 2.4 BC070053-1|AAH70053.1| 950|Homo sapiens PTPRN protein protein. 32 2.4 BC034040-1|AAH34040.1| 986|Homo sapiens protein tyrosine phosph... 32 2.4 BC007713-1|AAH07713.2| 811|Homo sapiens PTPRN protein protein. 32 2.4 AF007555-1|AAB63600.1| 1015|Homo sapiens IAR/receptor-like prote... 32 2.4 AC114803-2|AAY24038.1| 979|Homo sapiens unknown protein. 32 2.4 AB002385-1|BAA20841.2| 1042|Homo sapiens KIAA0387 protein. 32 2.4 BC015728-1|AAH15728.1| 393|Homo sapiens TTC23 protein protein. 30 7.2 AK023230-1|BAB14480.1| 391|Homo sapiens protein ( Homo sapiens ... 30 7.2 AJ001515-1|CAA04798.1| 4870|Homo sapiens ryanodine receptor 3 pr... 30 7.2 AF411456-1|AAQ03215.1| 447|Homo sapiens proto-oncogene 8 protein. 30 7.2 AB001025-1|BAA23795.1| 4866|Homo sapiens brain ryanodine recepto... 30 7.2 >Y08569-1|CAA69880.1| 1015|Homo sapiens Islet Cell Autoantigen Releted protein. Length = 1015 Score = 31.9 bits (69), Expect = 2.4 Identities = 10/22 (45%), Positives = 18/22 (81%) Frame = -1 Query: 164 YKLNLVTDHVWFANYLPRVFYI 99 Y++NLV++H+W ++L R FY+ Sbjct: 871 YEVNLVSEHIWCEDFLVRSFYL 892 >X62899-1|CAA44688.2| 591|Homo sapiens Islet Cell Antigen 512 protein. Length = 591 Score = 31.9 bits (69), Expect = 2.4 Identities = 10/22 (45%), Positives = 18/22 (81%) Frame = -1 Query: 164 YKLNLVTDHVWFANYLPRVFYI 99 Y++NLV++H+W ++L R FY+ Sbjct: 447 YEVNLVSEHIWCEDFLVRSFYL 468 >U81561-1|AAB68603.1| 998|Homo sapiens protein tyrosine phosphatase receptor pi protein. Length = 998 Score = 31.9 bits (69), Expect = 2.4 Identities = 10/22 (45%), Positives = 18/22 (81%) Frame = -1 Query: 164 YKLNLVTDHVWFANYLPRVFYI 99 Y++NLV++H+W ++L R FY+ Sbjct: 854 YEVNLVSEHIWCEDFLVRSFYL 875 >U66702-1|AAC50742.1| 1015|Homo sapiens phogrin protein. Length = 1015 Score = 31.9 bits (69), Expect = 2.4 Identities = 10/22 (45%), Positives = 18/22 (81%) Frame = -1 Query: 164 YKLNLVTDHVWFANYLPRVFYI 99 Y++NLV++H+W ++L R FY+ Sbjct: 871 YEVNLVSEHIWCEDFLVRSFYL 892 >U65065-1|AAC51643.1| 986|Homo sapiens tyrosine phosphatase IA-2beta protein. Length = 986 Score = 31.9 bits (69), Expect = 2.4 Identities = 10/22 (45%), Positives = 18/22 (81%) Frame = -1 Query: 164 YKLNLVTDHVWFANYLPRVFYI 99 Y++NLV++H+W ++L R FY+ Sbjct: 842 YEVNLVSEHIWCEDFLVRSFYL 863 >L18983-1|AAA90974.1| 979|Homo sapiens tyrosine phosphatase protein. Length = 979 Score = 31.9 bits (69), Expect = 2.4 Identities = 10/22 (45%), Positives = 18/22 (81%) Frame = -1 Query: 164 YKLNLVTDHVWFANYLPRVFYI 99 Y++NLV++H+W ++L R FY+ Sbjct: 835 YEVNLVSEHIWCEDFLVRSFYL 856 >BT006975-1|AAP35621.1| 591|Homo sapiens protein tyrosine phosphatase, receptor type, N protein. Length = 591 Score = 31.9 bits (69), Expect = 2.4 Identities = 10/22 (45%), Positives = 18/22 (81%) Frame = -1 Query: 164 YKLNLVTDHVWFANYLPRVFYI 99 Y++NLV++H+W ++L R FY+ Sbjct: 447 YEVNLVSEHIWCEDFLVRSFYL 468 >BC070053-1|AAH70053.1| 950|Homo sapiens PTPRN protein protein. Length = 950 Score = 31.9 bits (69), Expect = 2.4 Identities = 10/22 (45%), Positives = 18/22 (81%) Frame = -1 Query: 164 YKLNLVTDHVWFANYLPRVFYI 99 Y++NLV++H+W ++L R FY+ Sbjct: 806 YEVNLVSEHIWCEDFLVRSFYL 827 >BC034040-1|AAH34040.1| 986|Homo sapiens protein tyrosine phosphatase, receptor type, N polypeptide 2 protein. Length = 986 Score = 31.9 bits (69), Expect = 2.4 Identities = 10/22 (45%), Positives = 18/22 (81%) Frame = -1 Query: 164 YKLNLVTDHVWFANYLPRVFYI 99 Y++NLV++H+W ++L R FY+ Sbjct: 842 YEVNLVSEHIWCEDFLVRSFYL 863 >BC007713-1|AAH07713.2| 811|Homo sapiens PTPRN protein protein. Length = 811 Score = 31.9 bits (69), Expect = 2.4 Identities = 10/22 (45%), Positives = 18/22 (81%) Frame = -1 Query: 164 YKLNLVTDHVWFANYLPRVFYI 99 Y++NLV++H+W ++L R FY+ Sbjct: 667 YEVNLVSEHIWCEDFLVRSFYL 688 >AF007555-1|AAB63600.1| 1015|Homo sapiens IAR/receptor-like protein-tyrosine phosphatase precursor protein. Length = 1015 Score = 31.9 bits (69), Expect = 2.4 Identities = 10/22 (45%), Positives = 18/22 (81%) Frame = -1 Query: 164 YKLNLVTDHVWFANYLPRVFYI 99 Y++NLV++H+W ++L R FY+ Sbjct: 871 YEVNLVSEHIWCEDFLVRSFYL 892 >AC114803-2|AAY24038.1| 979|Homo sapiens unknown protein. Length = 979 Score = 31.9 bits (69), Expect = 2.4 Identities = 10/22 (45%), Positives = 18/22 (81%) Frame = -1 Query: 164 YKLNLVTDHVWFANYLPRVFYI 99 Y++NLV++H+W ++L R FY+ Sbjct: 835 YEVNLVSEHIWCEDFLVRSFYL 856 >AB002385-1|BAA20841.2| 1042|Homo sapiens KIAA0387 protein. Length = 1042 Score = 31.9 bits (69), Expect = 2.4 Identities = 10/22 (45%), Positives = 18/22 (81%) Frame = -1 Query: 164 YKLNLVTDHVWFANYLPRVFYI 99 Y++NLV++H+W ++L R FY+ Sbjct: 898 YEVNLVSEHIWCEDFLVRSFYL 919 >BC015728-1|AAH15728.1| 393|Homo sapiens TTC23 protein protein. Length = 393 Score = 30.3 bits (65), Expect = 7.2 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = +1 Query: 190 PREPVHLL*RRAKYFYNKYQYTR*L*DLVYCLQL 291 PRE +HL +AK + N ++Y + + +LV C+ L Sbjct: 41 PREKLHLCEEKAKSYSNSHEYKQAVHELVRCVAL 74 >AK023230-1|BAB14480.1| 391|Homo sapiens protein ( Homo sapiens cDNA FLJ13168 fis, clone NT2RP3003795. ). Length = 391 Score = 30.3 bits (65), Expect = 7.2 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = +1 Query: 190 PREPVHLL*RRAKYFYNKYQYTR*L*DLVYCLQL 291 PRE +HL +AK + N ++Y + + +LV C+ L Sbjct: 41 PREKLHLCEEKAKSYSNSHEYKQAVHELVRCVAL 74 >AJ001515-1|CAA04798.1| 4870|Homo sapiens ryanodine receptor 3 protein. Length = 4870 Score = 30.3 bits (65), Expect = 7.2 Identities = 20/67 (29%), Positives = 34/67 (50%) Frame = -2 Query: 451 IILYIKLA*RYF*IQIFNRNR*EHDMQPRQRCDENIN*STYKCLCYITIRAQCAIVDNIR 272 + LY +A +F + +N++ E D +P +CD+ + + Y Y+ +RA I D I Sbjct: 4681 VYLYTVVAFNFF-RKFYNKS--EDDDEPDMKCDDMM--TCYLFHMYVGVRAGGGIGDEIE 4735 Query: 271 DPKATLY 251 DP Y Sbjct: 4736 DPAGDPY 4742 >AF411456-1|AAQ03215.1| 447|Homo sapiens proto-oncogene 8 protein. Length = 447 Score = 30.3 bits (65), Expect = 7.2 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = +1 Query: 190 PREPVHLL*RRAKYFYNKYQYTR*L*DLVYCLQL 291 PRE +HL +AK + N ++Y + + +LV C+ L Sbjct: 41 PREKLHLCEEKAKSYSNSHEYKQAVHELVRCVAL 74 >AB001025-1|BAA23795.1| 4866|Homo sapiens brain ryanodine receptor protein. Length = 4866 Score = 30.3 bits (65), Expect = 7.2 Identities = 20/67 (29%), Positives = 34/67 (50%) Frame = -2 Query: 451 IILYIKLA*RYF*IQIFNRNR*EHDMQPRQRCDENIN*STYKCLCYITIRAQCAIVDNIR 272 + LY +A +F + +N++ E D +P +CD+ + + Y Y+ +RA I D I Sbjct: 4677 VYLYTVVAFNFF-RKFYNKS--EDDDEPDMKCDDMM--TCYLFHMYVGVRAGGGIGDEIE 4731 Query: 271 DPKATLY 251 DP Y Sbjct: 4732 DPAGDPY 4738 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 110,178,551 Number of Sequences: 237096 Number of extensions: 2300689 Number of successful extensions: 3618 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 3524 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3618 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8399192100 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -