BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20019 (700 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36662| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_9811| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_6589| Best HMM Match : zf-C2H2 (HMM E-Value=1.2e-36) 28 8.4 >SB_36662| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +2 Query: 461 NVNGLCEISVDRFCIISFSLKIKFSRIWIFIYLMILF 571 N+ G+ I V CII+F L S F+YLM+ F Sbjct: 130 NILGITFIFVLLSCIIAFELMTSLSAYQQFLYLMVTF 166 >SB_9811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 333 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/51 (21%), Positives = 28/51 (54%) Frame = +2 Query: 422 YFIWCFYLNIICFNVNGLCEISVDRFCIISFSLKIKFSRIWIFIYLMILFI 574 +F+W IC ++ L +++ R +I K + ++FI++++++I Sbjct: 103 WFVWPTMTVTICLSIFTLTSMAIHRRKVILNPFKPEIKHRYVFIWIVVIWI 153 >SB_6589| Best HMM Match : zf-C2H2 (HMM E-Value=1.2e-36) Length = 651 Score = 27.9 bits (59), Expect = 8.4 Identities = 13/53 (24%), Positives = 26/53 (49%) Frame = -3 Query: 176 ATRKTNEHMKNFKISRTKKFMRPITKVSSSPQCIYVKLLTGQDIYERWIDTSD 18 AT K+N+ ++ + T + + + + PQC + G+D+ + DT D Sbjct: 442 ATSKSNQGVRKAEEKGTHQIDVQVMESTDIPQCHATNAIAGEDVKAKKEDTED 494 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,393,717 Number of Sequences: 59808 Number of extensions: 322872 Number of successful extensions: 550 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 502 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 550 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -