BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20017 (560 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ271740-1|CAB93524.1| 16215|Drosophila melanogaster D-Titin pro... 28 9.9 AJ245406-1|CAB76253.1| 4001|Drosophila melanogaster kettin protein. 28 9.9 AE014296-406|AAF47604.1| 4796|Drosophila melanogaster CG1915-PA,... 28 9.9 AE014296-405|AAG22226.2| 18074|Drosophila melanogaster CG1915-PC... 28 9.9 AB026845-1|BAA90301.2| 4796|Drosophila melanogaster kettin protein. 28 9.9 >AJ271740-1|CAB93524.1| 16215|Drosophila melanogaster D-Titin protein. Length = 16215 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 Query: 272 YKTHLRQWAKEHEGWSVAVEKAISDCVDKDLR 367 + THL+ + K HEG V +E + D +LR Sbjct: 2624 FTTHLQSYDKLHEGQHVLLEAQVEPRADPNLR 2655 >AJ245406-1|CAB76253.1| 4001|Drosophila melanogaster kettin protein. Length = 4001 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 Query: 272 YKTHLRQWAKEHEGWSVAVEKAISDCVDKDLR 367 + THL+ + K HEG V +E + D +LR Sbjct: 2626 FTTHLQSYDKLHEGQHVLLEAQVEPRADPNLR 2657 >AE014296-406|AAF47604.1| 4796|Drosophila melanogaster CG1915-PA, isoform A protein. Length = 4796 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 Query: 272 YKTHLRQWAKEHEGWSVAVEKAISDCVDKDLR 367 + THL+ + K HEG V +E + D +LR Sbjct: 2624 FTTHLQSYDKLHEGQHVLLEAQVEPRADPNLR 2655 >AE014296-405|AAG22226.2| 18074|Drosophila melanogaster CG1915-PC, isoform C protein. Length = 18074 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 Query: 272 YKTHLRQWAKEHEGWSVAVEKAISDCVDKDLR 367 + THL+ + K HEG V +E + D +LR Sbjct: 2624 FTTHLQSYDKLHEGQHVLLEAQVEPRADPNLR 2655 >AB026845-1|BAA90301.2| 4796|Drosophila melanogaster kettin protein. Length = 4796 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 Query: 272 YKTHLRQWAKEHEGWSVAVEKAISDCVDKDLR 367 + THL+ + K HEG V +E + D +LR Sbjct: 2624 FTTHLQSYDKLHEGQHVLLEAQVEPRADPNLR 2655 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,420,004 Number of Sequences: 53049 Number of extensions: 535319 Number of successful extensions: 1657 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1597 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1657 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2172596895 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -