BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20016 (648 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 25 0.41 DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 25 0.54 AY052624-1|AAL15472.1| 212|Tribolium castaneum kynurenine 3-mon... 23 1.6 AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-mon... 23 1.6 AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-mon... 23 1.6 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 21 8.7 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 25.4 bits (53), Expect = 0.41 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +1 Query: 163 NVDLIPKFLMANGLLVKLLIHTGVTRYLEFN 255 N+D IP ++ L+ +LIH G T+++ N Sbjct: 446 NIDPIPLVVVLTHLIPFMLIHQGETQFVVAN 476 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 25.0 bits (52), Expect = 0.54 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = -2 Query: 179 GIKSTFQSRPRPYVSSGAGALNLANSSSNGVIDADSPP 66 G+ ST S P P +S+ G A+++SN + PP Sbjct: 126 GVISTNTSPPSPILSNRFGENEEADAASNVISSTPLPP 163 >AY052624-1|AAL15472.1| 212|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 212 Score = 23.4 bits (48), Expect = 1.6 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +1 Query: 154 RDWNVDLIPKFLMANGLLVKLLIHTGVTRYL 246 R W +I KFL GL+ L G+ +L Sbjct: 181 RKWQNKVIQKFLWTGGLVTSALFAYGLRIWL 211 >AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 23.4 bits (48), Expect = 1.6 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +1 Query: 154 RDWNVDLIPKFLMANGLLVKLLIHTGVTRYL 246 R W +I KFL GL+ L G+ +L Sbjct: 414 RKWQNKVIQKFLWTGGLVTSALFAYGLRIWL 444 >AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 23.4 bits (48), Expect = 1.6 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +1 Query: 154 RDWNVDLIPKFLMANGLLVKLLIHTGVTRYL 246 R W +I KFL GL+ L G+ +L Sbjct: 414 RKWQNKVIQKFLWTGGLVTSALFAYGLRIWL 444 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 21.0 bits (42), Expect = 8.7 Identities = 11/27 (40%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = +1 Query: 124 PAP-DETYGRGRDWNVDLIPKFLMANG 201 P+P E R D N+D K+ M+NG Sbjct: 261 PSPLYELVDRRNDENIDAQVKYWMSNG 287 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,304 Number of Sequences: 336 Number of extensions: 3299 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16656800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -