BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20016 (648 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g44100.1 68415.m05484 Rab GDP dissociation inhibitor (GDI1) i... 102 2e-22 At3g59920.1 68416.m06687 Rab GDP dissociation inhibitor (GDI2) i... 101 4e-22 At5g09550.1 68418.m01106 Rab GDP dissociation inhibitor, putativ... 97 9e-21 At3g06540.1 68416.m00758 GDP dissociation inhibitor family prote... 33 0.22 At4g37190.1 68417.m05265 expressed protein 31 0.87 At4g02990.1 68417.m00406 mitochondrial transcription termination... 29 3.5 At3g01840.1 68416.m00125 protein kinase family protein contains ... 29 3.5 At2g10965.1 68415.m01171 hypothetical protein 29 3.5 At3g17830.1 68416.m02273 DNAJ heat shock family protein similar ... 28 4.7 At3g02280.1 68416.m00209 flavodoxin family protein low similarit... 28 4.7 At1g79020.1 68414.m09214 transcription factor-related similar to... 28 4.7 At5g04340.1 68418.m00426 zinc finger (C2H2 type) family protein ... 28 6.1 >At2g44100.1 68415.m05484 Rab GDP dissociation inhibitor (GDI1) identical to GDP dissociation inhibitor [Arabidopsis thaliana] GI:1655424 Length = 445 Score = 102 bits (245), Expect = 2e-22 Identities = 50/85 (58%), Positives = 63/85 (74%), Gaps = 1/85 (1%) Frame = +1 Query: 1 ILSGMLSVSGKKVLHIDRNKYYGGESASITPLEELFAKFNAPAPDETY-GRGRDWNVDLI 177 ILSG+LSV G KVLH+DRN YYGGES S+ L +L+ KF + G RD+NVD++ Sbjct: 18 ILSGLLSVDGLKVLHMDRNDYYGGESTSLN-LNQLWKKFRGEEKAPAHLGSSRDYNVDMM 76 Query: 178 PKFLMANGLLVKLLIHTGVTRYLEF 252 PKF+MANG LV++LIHT VT+YL F Sbjct: 77 PKFMMANGKLVRVLIHTDVTKYLSF 101 Score = 85.8 bits (203), Expect = 2e-17 Identities = 41/86 (47%), Positives = 53/86 (61%) Frame = +3 Query: 255 SIEGSYVYKGGKISKVPVDQKEALASDLMGMFEKRRFRNFLIYVQDFQEEDAKTWKDFDP 434 +++GSYV+ GK+ KVP EAL S LMG+FEKRR F YVQ++ E+D KT D Sbjct: 103 AVDGSYVFVQGKVQKVPATPMEALKSPLMGIFEKRRAGKFFSYVQEYDEKDPKTHDGMDL 162 Query: 435 STANMQSLYDKFGLDRNTQDFTGHAL 512 + L KFGL +T DF GHA+ Sbjct: 163 RRVTTKDLIAKFGLKEDTIDFIGHAV 188 Score = 41.5 bits (93), Expect = 5e-04 Identities = 16/31 (51%), Positives = 26/31 (83%) Frame = +2 Query: 509 LALYLDDNYLQQPAIQTIRRIKLYSDSLAKY 601 +AL+ +DN+L QPA T+ R+KLY++SLA++ Sbjct: 188 VALHCNDNHLHQPAYDTVMRMKLYAESLARF 218 >At3g59920.1 68416.m06687 Rab GDP dissociation inhibitor (GDI2) identical to Rab GDP dissociation inhibitor AtGDI2 [Arabidopsis thaliana] GI:2446981 Length = 444 Score = 101 bits (242), Expect = 4e-22 Identities = 52/86 (60%), Positives = 63/86 (73%), Gaps = 2/86 (2%) Frame = +1 Query: 1 ILSGMLSVSGKKVLHIDRNKYYGGESASITPLEELFAKFNAP--APDETYGRGRDWNVDL 174 ILSG+LSV G KVLH+DRN YYGGES S+ L +L+ KF AP E G RD+NVD+ Sbjct: 18 ILSGLLSVDGVKVLHMDRNDYYGGESTSLN-LNQLWKKFRGEEKAP-EHLGASRDYNVDM 75 Query: 175 IPKFLMANGLLVKLLIHTGVTRYLEF 252 +PKF+M NG LV+ LIHT VT+YL F Sbjct: 76 MPKFMMGNGKLVRTLIHTDVTKYLSF 101 Score = 88.2 bits (209), Expect = 4e-18 Identities = 41/86 (47%), Positives = 55/86 (63%) Frame = +3 Query: 255 SIEGSYVYKGGKISKVPVDQKEALASDLMGMFEKRRFRNFLIYVQDFQEEDAKTWKDFDP 434 +++GSYV+ GK+ KVP EAL S LMG+FEKRR F +VQ++ E+D KT D Sbjct: 103 AVDGSYVFVKGKVQKVPATPMEALKSSLMGIFEKRRAGKFFSFVQEYDEKDPKTHDGMDL 162 Query: 435 STANMQSLYDKFGLDRNTQDFTGHAL 512 + + L K+GLD NT DF GHA+ Sbjct: 163 TRVTTKELIAKYGLDGNTIDFIGHAV 188 Score = 39.5 bits (88), Expect = 0.002 Identities = 15/31 (48%), Positives = 25/31 (80%) Frame = +2 Query: 509 LALYLDDNYLQQPAIQTIRRIKLYSDSLAKY 601 +AL+ +D +L QPA T+ R+KLY++SLA++ Sbjct: 188 VALHTNDQHLDQPAFDTVMRMKLYAESLARF 218 >At5g09550.1 68418.m01106 Rab GDP dissociation inhibitor, putative strong similarity to GDP dissociation inhibitor protein OsGDI1 [Oryza sativa] GI:2384758; contains Pfam profile PF00996: GDP dissociation inhibitor Length = 365 Score = 97.1 bits (231), Expect = 9e-21 Identities = 45/86 (52%), Positives = 59/86 (68%) Frame = +3 Query: 255 SIEGSYVYKGGKISKVPVDQKEALASDLMGMFEKRRFRNFLIYVQDFQEEDAKTWKDFDP 434 +++GS+VYK GKI KVP EAL S LMG+FEKRR R F IYVQD+ E+D K+ + D Sbjct: 23 AVDGSFVYKKGKIYKVPATDVEALKSPLMGLFEKRRARKFFIYVQDYDEKDPKSHEGLDL 82 Query: 435 STANMQSLYDKFGLDRNTQDFTGHAL 512 S + + K+GL+ +T DF GHAL Sbjct: 83 SKVTAREIISKYGLEDDTIDFIGHAL 108 Score = 45.6 bits (103), Expect = 3e-05 Identities = 19/31 (61%), Positives = 27/31 (87%) Frame = +2 Query: 509 LALYLDDNYLQQPAIQTIRRIKLYSDSLAKY 601 LAL+ DD+YL QPAI ++RIKLY++SLA++ Sbjct: 108 LALHNDDDYLDQPAIDFVKRIKLYAESLARF 138 Score = 36.7 bits (81), Expect = 0.013 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 190 MANGLLVKLLIHTGVTRYLEF 252 MANGLLV+ LIHT VT+YL F Sbjct: 1 MANGLLVQTLIHTDVTKYLNF 21 >At3g06540.1 68416.m00758 GDP dissociation inhibitor family protein / Rab GTPase activator family protein similar to SP|P26374 Rab proteins geranylgeranyltransferase component A 2 (Rab escort protein 2) {Homo sapiens}; contains Pfam profile PF00996: GDP dissociation inhibitor Length = 563 Score = 32.7 bits (71), Expect = 0.22 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +1 Query: 1 ILSGMLSVSGKKVLHIDRNKYYGGESASIT-PLEELFAKFNAPAP 132 +L+ S SG VLH+D N +YG AS++ P F N+ +P Sbjct: 28 VLAAAASSSGSSVLHLDPNPFYGSHFASLSLPDLTSFLHSNSVSP 72 >At4g37190.1 68417.m05265 expressed protein Length = 562 Score = 30.7 bits (66), Expect = 0.87 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +3 Query: 399 EEDAKTWKDFDPSTANMQSLYDKFGLDRNTQDFTGHAL 512 +E+ + W DF S + QSLY+ GL ++Q F + + Sbjct: 146 DEEVECWTDFSKSHYHPQSLYELNGLWMDSQAFNNYGI 183 >At4g02990.1 68417.m00406 mitochondrial transcription termination factor family protein / mTERF family protein weak similarity to mtDBP protein [Paracentrotus lividus] GI:4584695; contains Pfam profile PF02536: mTERF Length = 541 Score = 28.7 bits (61), Expect = 3.5 Identities = 21/61 (34%), Positives = 34/61 (55%), Gaps = 1/61 (1%) Frame = -2 Query: 497 EILGVSI*PKLIVQRLHVCS*GIKILP-CLGIFFLEILNVD*EVAETPLLKHAHKIRRKS 321 EI+G+ + PKL QR +CS I + P LG +E + ++E+P+LKH + + Sbjct: 349 EIIGIDLKPKLDTQRKLLCS-AIHLNPEDLG-SLIERMPQFVSLSESPMLKHIDFLTKCG 406 Query: 320 F 318 F Sbjct: 407 F 407 >At3g01840.1 68416.m00125 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 654 Score = 28.7 bits (61), Expect = 3.5 Identities = 12/34 (35%), Positives = 22/34 (64%) Frame = -1 Query: 477 LTQTYRTATACLQLRDQNPSMSWHLLPGNLERRL 376 ++Q+ + T CL +R++NP +S L N++ RL Sbjct: 124 VSQSLQGLTTCLSIREKNPHISEDKLGDNIKLRL 157 >At2g10965.1 68415.m01171 hypothetical protein Length = 249 Score = 28.7 bits (61), Expect = 3.5 Identities = 14/35 (40%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Frame = +3 Query: 417 WKDFDPST--ANMQSLYDKFGLDRNTQDFTGHALP 515 WKD+ P A+ +D GLDR GH LP Sbjct: 198 WKDWSPMKLKASQTVFFDSQGLDRECSLLGGHILP 232 >At3g17830.1 68416.m02273 DNAJ heat shock family protein similar to SP|P35514 Chaperone protein dnaJ {Lactococcus lactis}; contains Pfam profiles PF00226: DnaJ domain, PF01556: DnaJ C terminal region, PF00684: DnaJ central domain (4 repeats) Length = 517 Score = 28.3 bits (60), Expect = 4.7 Identities = 18/52 (34%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Frame = -2 Query: 629 TMGKGKETYHTSLVNQNTT*CGEWSG*QAVANNYHP--NKGQGMSSEILGVS 480 TM G + Y T VN+N T S + +A YHP NK G + +S Sbjct: 57 TMAAGTDHYSTLNVNRNATLQEIKSSYRKLARKYHPDMNKNPGAEDKFKQIS 108 >At3g02280.1 68416.m00209 flavodoxin family protein low similarity to SP|Q05001 NADPH-cytochrome P450 reductase (EC 1.6.2.4) {Catharanthus roseus}, similar to NADPH-dependent FMN and FAD containing oxidoreductase [Homo sapiens] GI:6694369; contains Pfam profiles PF00258: flavodoxin, PF00667: FAD binding domain, PF00175: Oxidoreductase NAD-binding domain Length = 623 Score = 28.3 bits (60), Expect = 4.7 Identities = 24/107 (22%), Positives = 44/107 (41%), Gaps = 7/107 (6%) Frame = +3 Query: 291 ISKVPVDQKE--ALASDLMGMFEKRRFRNFLIYVQDFQEEDAKTWKDFDPSTANMQSLYD 464 I+++P+ K L D+ +R F + + + E + + S LY+ Sbjct: 306 ITQIPIKLKTFVELTMDVTSASPRRYFFEIMSFYATAEHEKERL--QYFASPEGRDDLYN 363 Query: 465 KFGLDRNT-----QDFTGHALPFIWMIIICNSLLSRPFAASSCILIH 590 +R + +DF +PF W++ + L R F+ SS L H Sbjct: 364 YNQKERRSILEVLEDFPSVQIPFDWLVQLVPPLKPRAFSISSSPLAH 410 >At1g79020.1 68414.m09214 transcription factor-related similar to enhancer of polycomb (GI:3757890) [Drosophila melanogaster]; similar to enhancer of polycomb (GI:11907923) [Homo sapiens] Length = 453 Score = 28.3 bits (60), Expect = 4.7 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = -2 Query: 389 LNVD*EVAETPLLKHAHKIRRKSFFLIDRYFGDFS-TFVNITSF 261 + VD EVA P K A +I F ++D Y D+S TF S+ Sbjct: 47 VEVDNEVAPVPSKKPASEIPTPQFVIVDTYERDYSPTFGQPASY 90 >At5g04340.1 68418.m00426 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 238 Score = 27.9 bits (59), Expect = 6.1 Identities = 19/61 (31%), Positives = 32/61 (52%) Frame = +1 Query: 19 SVSGKKVLHIDRNKYYGGESASITPLEELFAKFNAPAPDETYGRGRDWNVDLIPKFLMAN 198 ++ G K H + K GG S+S++ E++ + + + RG D N+ IP+F M N Sbjct: 162 ALGGHKRCHYE-GKNGGGVSSSVSNSEDVGSTSHVSSGH----RGFDLNIPPIPEFSMVN 216 Query: 199 G 201 G Sbjct: 217 G 217 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,814,730 Number of Sequences: 28952 Number of extensions: 314096 Number of successful extensions: 821 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 801 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 819 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1344285648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -