BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20012 (652 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 23 1.6 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 22 3.8 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 22 3.8 AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 22 5.0 AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein p... 22 5.0 AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein p... 22 5.0 AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein pr... 21 6.7 AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 21 6.7 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 6.7 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 6.7 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 21 6.7 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 6.7 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 23.4 bits (48), Expect = 1.6 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -2 Query: 249 NDARTISWLHQT*SCSHSEKLLR 181 N +TISWL H+E +LR Sbjct: 354 NPIKTISWLKDGHPIDHNEAVLR 376 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 22.2 bits (45), Expect = 3.8 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +2 Query: 71 VLCPFQFSGSFTEKMASIPVYEEYHFETLRW 163 ++ PF G F ++SIP+Y ++ L W Sbjct: 564 LVIPFLLFGGFFLNVSSIPIYFKW-LSFLSW 593 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 22.2 bits (45), Expect = 3.8 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +2 Query: 71 VLCPFQFSGSFTEKMASIPVYEEYHFETLRW 163 ++ PF G F ++SIP+Y ++ L W Sbjct: 564 LVIPFLLFGGFFLNVSSIPIYFKW-LSFLSW 593 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 21.8 bits (44), Expect = 5.0 Identities = 9/31 (29%), Positives = 11/31 (35%) Frame = +2 Query: 440 RHYRMHQQGKPTSTNPVASIYAWQEVLHTGP 532 R + MH PV Y W +V P Sbjct: 177 RQHVMHNLSSVPQPQPVLPTYKWMQVKRNVP 207 >AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein protein. Length = 210 Score = 21.8 bits (44), Expect = 5.0 Identities = 9/31 (29%), Positives = 11/31 (35%) Frame = +2 Query: 440 RHYRMHQQGKPTSTNPVASIYAWQEVLHTGP 532 R + MH PV Y W +V P Sbjct: 177 RQHVMHNLSSVPQPQPVLPTYKWMQVKRNVP 207 >AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein protein. Length = 253 Score = 21.8 bits (44), Expect = 5.0 Identities = 9/31 (29%), Positives = 11/31 (35%) Frame = +2 Query: 440 RHYRMHQQGKPTSTNPVASIYAWQEVLHTGP 532 R + MH PV Y W +V P Sbjct: 177 RQHVMHNLSSVPQPQPVLPTYKWMQVKRNVP 207 >AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein protein. Length = 136 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 419 SAHGTVTRHYRMHQQGKP 472 S T+T+H R+H KP Sbjct: 88 SDSSTLTKHLRIHSGEKP 105 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 21.4 bits (43), Expect = 6.7 Identities = 12/39 (30%), Positives = 16/39 (41%) Frame = +1 Query: 322 RCAVRYCCSGLRVIGNDDISIDVSRWPYRGIRIGARDGD 438 +C Y G R + ND++S I A DGD Sbjct: 125 QCMYMYFLLGFRYLVNDELSAHSKEIRGENTYILALDGD 163 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.4 bits (43), Expect = 6.7 Identities = 12/39 (30%), Positives = 16/39 (41%) Frame = +1 Query: 322 RCAVRYCCSGLRVIGNDDISIDVSRWPYRGIRIGARDGD 438 +C Y G R + ND++S I A DGD Sbjct: 439 QCMYMYFLLGFRYLVNDELSAHSKEIRGENTYILALDGD 477 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 6.7 Identities = 12/39 (30%), Positives = 16/39 (41%) Frame = +1 Query: 322 RCAVRYCCSGLRVIGNDDISIDVSRWPYRGIRIGARDGD 438 +C Y G R+ ND++S I A DGD Sbjct: 672 QCMYMYFLLGFRLQANDELSAHSKEIRGENTYILALDGD 710 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 419 SAHGTVTRHYRMHQQGKP 472 S T+T+H R+H KP Sbjct: 344 SDSSTLTKHLRIHSGEKP 361 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 6.7 Identities = 12/39 (30%), Positives = 16/39 (41%) Frame = +1 Query: 322 RCAVRYCCSGLRVIGNDDISIDVSRWPYRGIRIGARDGD 438 +C Y G R+ ND++S I A DGD Sbjct: 672 QCMYMYFLLGFRLQANDELSAHSKEIRGENTYILALDGD 710 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,045 Number of Sequences: 336 Number of extensions: 3916 Number of successful extensions: 14 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16760905 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -