BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20010 (420 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 26 0.48 AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. 23 6.0 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 26.2 bits (55), Expect = 0.48 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +2 Query: 260 ELLAKITSLNESPSVHGIIVQMPLDSDHAIDAHR 361 E+L ITSL S + G++VQ L D DA R Sbjct: 1633 EILIFITSLRVSVWLEGVVVQETLLEDVKSDAER 1666 >AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. Length = 458 Score = 22.6 bits (46), Expect = 6.0 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 61 QDL*KMTCVNK*RGCVQNGLASSPGLPS 144 +++ K+ CV+ R VQN S P L S Sbjct: 385 EEMRKVVCVDNYRPSVQNRWTSDPFLAS 412 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 384,059 Number of Sequences: 2352 Number of extensions: 6292 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 34632603 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -