BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20009X (408 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 23 5.7 AY330182-1|AAQ16288.1| 181|Anopheles gambiae odorant-binding pr... 22 7.5 AJ618927-1|CAF02006.1| 235|Anopheles gambiae odorant-binding pr... 22 7.5 AJ007394-1|CAA07489.1| 112|Anopheles gambiae mucin protein. 22 7.5 AF046924-1|AAC08530.1| 122|Anopheles gambiae mucin protein. 22 7.5 DQ013848-1|AAY40257.1| 304|Anopheles gambiae CYP325D1 protein. 22 9.9 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 22.6 bits (46), Expect = 5.7 Identities = 12/45 (26%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -1 Query: 342 FGEDKSELNWETMPGRCPW-SPGAKVDRRTHAVHLVVSYQFVHDI 211 F +K + + G CPW P K R +H + + H I Sbjct: 239 FNMNKQQQRLTGVHGGCPWRPPNFKYGRGIIGLHQEIEQFYAHMI 283 >AY330182-1|AAQ16288.1| 181|Anopheles gambiae odorant-binding protein AgamOBP56 protein. Length = 181 Score = 22.2 bits (45), Expect = 7.5 Identities = 6/34 (17%), Positives = 20/34 (58%) Frame = +3 Query: 180 IRGEEERSHHKCREQTDTKQQDELHEYAYQLWLQ 281 ++ ++ + +KC +T+ +++HE Q +++ Sbjct: 24 VQDDKCKRKYKCCNDANTENMEKIHEIKKQCFME 57 >AJ618927-1|CAF02006.1| 235|Anopheles gambiae odorant-binding protein OBPjj7a protein. Length = 235 Score = 22.2 bits (45), Expect = 7.5 Identities = 6/34 (17%), Positives = 20/34 (58%) Frame = +3 Query: 180 IRGEEERSHHKCREQTDTKQQDELHEYAYQLWLQ 281 ++ ++ + +KC +T+ +++HE Q +++ Sbjct: 52 VQDDKCKRKYKCCNDANTENMEKIHEIKKQCFME 85 >AJ007394-1|CAA07489.1| 112|Anopheles gambiae mucin protein. Length = 112 Score = 22.2 bits (45), Expect = 7.5 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = -2 Query: 320 STGKQCPDDVLGALEPKLIGVLMQFILL 237 +T P DV AL P L+G + +L Sbjct: 83 TTPSSAPQDVKAALVPVLLGAYVAMSIL 110 >AF046924-1|AAC08530.1| 122|Anopheles gambiae mucin protein. Length = 122 Score = 22.2 bits (45), Expect = 7.5 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = -2 Query: 320 STGKQCPDDVLGALEPKLIGVLMQFILL 237 +T P DV AL P L+G + +L Sbjct: 93 TTPSSAPQDVKAALVPVLLGAYVAMSIL 120 >DQ013848-1|AAY40257.1| 304|Anopheles gambiae CYP325D1 protein. Length = 304 Score = 21.8 bits (44), Expect = 9.9 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +1 Query: 238 NKMNCMSTPINFGSR 282 N+M C P N GSR Sbjct: 277 NRMGCAFMPFNTGSR 291 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 368,197 Number of Sequences: 2352 Number of extensions: 6376 Number of successful extensions: 56 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 56 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 56 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 32922351 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -