BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20003 (371 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g25040.1 68417.m03592 integral membrane family protein contai... 28 2.3 At4g13290.1 68417.m02078 cytochrome P450 71A19, putative (CYP71A... 27 3.0 At1g62250.2 68414.m07023 expressed protein 27 4.0 At1g62250.1 68414.m07022 expressed protein 27 4.0 At1g51610.1 68414.m05814 cation efflux family protein / metal to... 27 4.0 At4g17895.1 68417.m02667 ubiquitin-specific protease 20, putativ... 27 5.3 At3g07400.1 68416.m00882 lipase class 3 family protein contains ... 27 5.3 At1g31600.3 68414.m03879 oxidoreductase, 2OG-Fe(II) oxygenase fa... 27 5.3 At1g31600.2 68414.m03877 oxidoreductase, 2OG-Fe(II) oxygenase fa... 27 5.3 At1g31600.1 68414.m03878 oxidoreductase, 2OG-Fe(II) oxygenase fa... 27 5.3 At2g19520.1 68415.m02281 WD-40 repeat protein (MSI4) contains 6 ... 26 7.0 At1g09080.1 68414.m01013 luminal binding protein 3 (BiP-3) (BP3)... 26 9.2 >At4g25040.1 68417.m03592 integral membrane family protein contains TIGRFAM TIGR01569 : plant integral membrane protein TIGR01569; contains Pfam PF04535 : Domain of unknown function (DUF588) Length = 170 Score = 27.9 bits (59), Expect = 2.3 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = -2 Query: 181 SFRYSEHLAIAVSYSPMTTLIYSCPPVRHQFLV 83 +FRY + IAV + + TL+++C VR + LV Sbjct: 59 AFRYLVYAQIAVCAATLFTLVWACLAVRRRGLV 91 >At4g13290.1 68417.m02078 cytochrome P450 71A19, putative (CYP71A19) Identical to Cytochrome P450 (SP:Q9T0K0) [Arabidopsis thaliana]; similar to cytochrome P450LXXIA1, Persea americana, M32885 Length = 490 Score = 27.5 bits (58), Expect = 3.0 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -2 Query: 364 VPFVXELDSLLGEDHXKLDGEVRFDDFL 281 +P + +D + G+DH + + RFD+FL Sbjct: 224 IPSLSWIDKIRGQDHKMEEVDKRFDEFL 251 >At1g62250.2 68414.m07023 expressed protein Length = 223 Score = 27.1 bits (57), Expect = 4.0 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +2 Query: 29 LCLPSSSPCVRWLLTPHLHQELMTYWR 109 LC P + +RW TP + E+++ WR Sbjct: 181 LCTPQPT-VIRWSSTPSVSDEILSKWR 206 >At1g62250.1 68414.m07022 expressed protein Length = 267 Score = 27.1 bits (57), Expect = 4.0 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +2 Query: 29 LCLPSSSPCVRWLLTPHLHQELMTYWR 109 LC P + +RW TP + E+++ WR Sbjct: 181 LCTPQPT-VIRWSSTPSVSDEILSKWR 206 >At1g51610.1 68414.m05814 cation efflux family protein / metal tolerance protein, putative (MTPc4) member of the cation diffusion facilitator (CDF) family, or cation efflux (CE) family, PMID:11500563 Length = 457 Score = 27.1 bits (57), Expect = 4.0 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = -1 Query: 260 GXEVHGVPLAVFDQTLNGFLDNLSLLFLQIFRAFGD-SGLVFTN 132 G VH LA+FD+ NGF+D F + R+ GL+ TN Sbjct: 25 GGSVHF--LALFDEKDNGFVDTTHRSFSSLIRSSSHVRGLISTN 66 >At4g17895.1 68417.m02667 ubiquitin-specific protease 20, putative (UBP20) identical to ubiquitin-specific protease 20 GI:11993480 [Arabidopsis thaliana] Length = 695 Score = 26.6 bits (56), Expect = 5.3 Identities = 11/50 (22%), Positives = 26/50 (52%) Frame = -2 Query: 238 LLPFSIRRLTASLITSPFFSFRYSEHLAIAVSYSPMTTLIYSCPPVRHQF 89 L P+ +R + + +++ + + EH +V+Y ++ + S P + H F Sbjct: 402 LQPY-MRNIQENEVSTKYHLYALVEHFGYSVAYGHYSSYVRSAPKIWHHF 450 >At3g07400.1 68416.m00882 lipase class 3 family protein contains Pfam profile PF01764: Lipase Length = 1003 Score = 26.6 bits (56), Expect = 5.3 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = +1 Query: 94 DDVLADSCI*VSSLVNTRPLSPNALNI*RKRRERLSRKP 210 DDV D CI S + + PL N + ++ R KP Sbjct: 162 DDVAEDECIEASEPIQSEPLKNNGEGLRNPKQLRQKPKP 200 >At1g31600.3 68414.m03879 oxidoreductase, 2OG-Fe(II) oxygenase family protein contains Pfam profiles PF03171: oxidoreductase, 2OG-Fe(II) oxygenase family, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 431 Score = 26.6 bits (56), Expect = 5.3 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = -1 Query: 173 IFRAFGDSGLVFTNDDTHIQLSASTSSVLGASVALEA 63 +F FG+ V+ DD+ +++ S + A ALEA Sbjct: 130 VFAEFGEVNGVYAADDSGVRVIVSFADPFSAKAALEA 166 >At1g31600.2 68414.m03877 oxidoreductase, 2OG-Fe(II) oxygenase family protein contains Pfam profiles PF03171: oxidoreductase, 2OG-Fe(II) oxygenase family, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 344 Score = 26.6 bits (56), Expect = 5.3 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = -1 Query: 173 IFRAFGDSGLVFTNDDTHIQLSASTSSVLGASVALEA 63 +F FG+ V+ DD+ +++ S + A ALEA Sbjct: 45 VFAEFGEVNGVYAADDSGVRVIVSFADPFSAKAALEA 81 >At1g31600.1 68414.m03878 oxidoreductase, 2OG-Fe(II) oxygenase family protein contains Pfam profiles PF03171: oxidoreductase, 2OG-Fe(II) oxygenase family, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 431 Score = 26.6 bits (56), Expect = 5.3 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = -1 Query: 173 IFRAFGDSGLVFTNDDTHIQLSASTSSVLGASVALEA 63 +F FG+ V+ DD+ +++ S + A ALEA Sbjct: 130 VFAEFGEVNGVYAADDSGVRVIVSFADPFSAKAALEA 166 >At2g19520.1 68415.m02281 WD-40 repeat protein (MSI4) contains 6 (4 significant) WD-40 repeats (PF0400); identical to WD-40 repeat protein MSI4 (SP:O22607) [Arabidopsis thaliana] Length = 507 Score = 26.2 bits (55), Expect = 7.0 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = -2 Query: 229 FSIRRLTASLITSPFFSFRYSEHLAIAVSYSPMTTLIY 116 F R+LTA+ + SP + F + + V +SP + ++ Sbjct: 365 FDRRKLTANGVGSPIYKFEGHKAAVLCVQWSPDKSSVF 402 >At1g09080.1 68414.m01013 luminal binding protein 3 (BiP-3) (BP3) Similar to Arabidopsis luminal binding protein (gb|D89342); contains Pfam domain PF00012: dnaK protein Length = 678 Score = 25.8 bits (54), Expect = 9.2 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +3 Query: 120 MSVVIGEYETAIAKCSEYLKEKKGEVIKEAVKRLIENGKRNTMDF 254 M + + E K S+ KEK V+KEA++ L EN D+ Sbjct: 594 MKSTVADKEKLAKKISDEDKEKMEGVLKEALEWLEENVNAEKEDY 638 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,879,996 Number of Sequences: 28952 Number of extensions: 149121 Number of successful extensions: 496 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 490 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 496 length of database: 12,070,560 effective HSP length: 73 effective length of database: 9,957,064 effective search space used: 497853200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -