SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= epV32518
         (489 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ026039-1|AAY87898.1|  427|Apis mellifera nicotinic acetylcholi...    23   1.7  
AF388659-1|AAK71995.1|  782|Apis mellifera 1D-myo-inositol-trisp...    22   4.0  
DQ013068-1|AAY81956.1|  931|Apis mellifera dusty protein kinase ...    21   5.3  
DQ013067-1|AAY81955.1|  969|Apis mellifera dusty protein kinase ...    21   5.3  
AY463910-1|AAR24352.1|  843|Apis mellifera metabotropic glutamat...    21   5.3  
AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul...    21   5.3  
AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A...    21   5.3  
AB161181-1|BAD08343.1|  933|Apis mellifera metabotropic glutamat...    21   5.3  
AY569721-1|AAS86674.1|  400|Apis mellifera complementary sex det...    21   7.0  
AY569720-1|AAS86673.1|  406|Apis mellifera complementary sex det...    21   7.0  
AY569717-1|AAS86670.1|  397|Apis mellifera complementary sex det...    21   7.0  
AY569716-1|AAS86669.1|  406|Apis mellifera complementary sex det...    21   7.0  
AY569710-1|AAS86663.1|  408|Apis mellifera complementary sex det...    21   7.0  
AY569709-1|AAS86662.1|  408|Apis mellifera complementary sex det...    21   7.0  
AY569708-1|AAS86661.1|  408|Apis mellifera complementary sex det...    21   7.0  
AY569707-1|AAS86660.1|  408|Apis mellifera complementary sex det...    21   7.0  
AY569706-1|AAS86659.1|  397|Apis mellifera complementary sex det...    21   7.0  
AY569705-1|AAS86658.1|  419|Apis mellifera complementary sex det...    21   7.0  
AY569704-1|AAS86657.1|  426|Apis mellifera complementary sex det...    21   7.0  
AY569703-1|AAS86656.1|  396|Apis mellifera complementary sex det...    21   7.0  
AY569701-1|AAS86654.1|  407|Apis mellifera complementary sex det...    21   7.0  
AY569700-1|AAS86653.1|  407|Apis mellifera complementary sex det...    21   7.0  
AY569699-1|AAS86652.1|  396|Apis mellifera complementary sex det...    21   7.0  
AY569698-1|AAS86651.1|  407|Apis mellifera complementary sex det...    21   7.0  
AY569697-1|AAS86650.1|  413|Apis mellifera complementary sex det...    21   7.0  
AY569696-1|AAS86649.1|  414|Apis mellifera complementary sex det...    21   7.0  
AY569695-1|AAS86648.1|  414|Apis mellifera complementary sex det...    21   7.0  
AY569694-1|AAS86647.1|  400|Apis mellifera complementary sex det...    21   7.0  
AY352277-1|AAQ67418.1|  418|Apis mellifera complementary sex det...    21   7.0  
AY352276-1|AAQ67417.1|  385|Apis mellifera complementary sex det...    21   7.0  
AY350618-1|AAQ57660.1|  425|Apis mellifera complementary sex det...    21   7.0  
AY350617-1|AAQ57659.1|  428|Apis mellifera complementary sex det...    21   7.0  
AY350615-1|AAQ57657.1|  410|Apis mellifera complementary sex det...    21   7.0  

>DQ026039-1|AAY87898.1|  427|Apis mellifera nicotinic acetylcholine
           receptor beta2subunit protein.
          Length = 427

 Score = 23.0 bits (47), Expect = 1.7
 Identities = 10/27 (37%), Positives = 13/27 (48%)
 Frame = +2

Query: 257 CGREHTCWPCDFWELTQNIVEVSFTSD 337
           C  +HT WP D    T +I   S  S+
Sbjct: 159 CEYDHTWWPYDILNCTIHIASWSHGSN 185


>AF388659-1|AAK71995.1|  782|Apis mellifera
           1D-myo-inositol-trisphosphate 3-kinaseisoform A protein.
          Length = 782

 Score = 21.8 bits (44), Expect = 4.0
 Identities = 9/20 (45%), Positives = 10/20 (50%)
 Frame = -1

Query: 198 SLDVWIQHVCKPRRKSSRIC 139
           SLD     VC+ RR S   C
Sbjct: 337 SLDTQFLQVCRSRRHSDSCC 356


>DQ013068-1|AAY81956.1|  931|Apis mellifera dusty protein kinase
           isoform B protein.
          Length = 931

 Score = 21.4 bits (43), Expect = 5.3
 Identities = 12/38 (31%), Positives = 18/38 (47%)
 Frame = -1

Query: 363 LKTFLLSKPSLVKLTSTIFCVSSQKSQGQQVCSLPHLS 250
           LK  LL   +  KLT   FC++     G  V +  H++
Sbjct: 725 LKNVLLDIENRAKLTDFGFCITEVMMLGSIVGTPVHMA 762


>DQ013067-1|AAY81955.1|  969|Apis mellifera dusty protein kinase
           isoform A protein.
          Length = 969

 Score = 21.4 bits (43), Expect = 5.3
 Identities = 12/38 (31%), Positives = 18/38 (47%)
 Frame = -1

Query: 363 LKTFLLSKPSLVKLTSTIFCVSSQKSQGQQVCSLPHLS 250
           LK  LL   +  KLT   FC++     G  V +  H++
Sbjct: 763 LKNVLLDIENRAKLTDFGFCITEVMMLGSIVGTPVHMA 800


>AY463910-1|AAR24352.1|  843|Apis mellifera metabotropic glutamate
           receptor 1 protein.
          Length = 843

 Score = 21.4 bits (43), Expect = 5.3
 Identities = 9/25 (36%), Positives = 12/25 (48%)
 Frame = +2

Query: 215 SRCSSNMMNGVMLKCGREHTCWPCD 289
           S CS     G++ K   +  CW CD
Sbjct: 447 SACSLPCEPGMIKKQQGDTCCWVCD 471


>AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule
            AbsCAM-Ig7B protein.
          Length = 1923

 Score = 21.4 bits (43), Expect = 5.3
 Identities = 9/29 (31%), Positives = 15/29 (51%)
 Frame = +3

Query: 45   SPQGRHPSSFFFTKCRAEDHALSERRATP 131
            S  G HP++         +HA++E  A+P
Sbjct: 1726 SAAGLHPNNTLLHSFMYHEHAMTEGCASP 1754


>AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member
            AbsCAM-Ig7A protein.
          Length = 1919

 Score = 21.4 bits (43), Expect = 5.3
 Identities = 9/29 (31%), Positives = 15/29 (51%)
 Frame = +3

Query: 45   SPQGRHPSSFFFTKCRAEDHALSERRATP 131
            S  G HP++         +HA++E  A+P
Sbjct: 1722 SAAGLHPNNTLLHSFMYHEHAMTEGCASP 1750


>AB161181-1|BAD08343.1|  933|Apis mellifera metabotropic glutamate
           receptor protein.
          Length = 933

 Score = 21.4 bits (43), Expect = 5.3
 Identities = 9/25 (36%), Positives = 12/25 (48%)
 Frame = +2

Query: 215 SRCSSNMMNGVMLKCGREHTCWPCD 289
           S CS     G++ K   +  CW CD
Sbjct: 537 SACSLPCEPGMIKKQQGDTCCWVCD 561


>AY569721-1|AAS86674.1|  400|Apis mellifera complementary sex
           determiner protein.
          Length = 400

 Score = 21.0 bits (42), Expect = 7.0
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = -1

Query: 237 IILELHRDLP 208
           I LE+HRDLP
Sbjct: 120 IKLEIHRDLP 129


>AY569720-1|AAS86673.1|  406|Apis mellifera complementary sex
           determiner protein.
          Length = 406

 Score = 21.0 bits (42), Expect = 7.0
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = -1

Query: 237 IILELHRDLP 208
           I LE+HRDLP
Sbjct: 131 IKLEIHRDLP 140


>AY569717-1|AAS86670.1|  397|Apis mellifera complementary sex
           determiner protein.
          Length = 397

 Score = 21.0 bits (42), Expect = 7.0
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = -1

Query: 237 IILELHRDLP 208
           I LE+HRDLP
Sbjct: 120 IKLEIHRDLP 129


>AY569716-1|AAS86669.1|  406|Apis mellifera complementary sex
           determiner protein.
          Length = 406

 Score = 21.0 bits (42), Expect = 7.0
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = -1

Query: 237 IILELHRDLP 208
           I LE+HRDLP
Sbjct: 131 IKLEIHRDLP 140


>AY569710-1|AAS86663.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 21.0 bits (42), Expect = 7.0
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = -1

Query: 237 IILELHRDLP 208
           I LE+HRDLP
Sbjct: 131 IKLEIHRDLP 140


>AY569709-1|AAS86662.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 21.0 bits (42), Expect = 7.0
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = -1

Query: 237 IILELHRDLP 208
           I LE+HRDLP
Sbjct: 131 IKLEIHRDLP 140


>AY569708-1|AAS86661.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 21.0 bits (42), Expect = 7.0
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = -1

Query: 237 IILELHRDLP 208
           I LE+HRDLP
Sbjct: 131 IKLEIHRDLP 140


>AY569707-1|AAS86660.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 21.0 bits (42), Expect = 7.0
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = -1

Query: 237 IILELHRDLP 208
           I LE+HRDLP
Sbjct: 131 IKLEIHRDLP 140


>AY569706-1|AAS86659.1|  397|Apis mellifera complementary sex
           determiner protein.
          Length = 397

 Score = 21.0 bits (42), Expect = 7.0
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = -1

Query: 237 IILELHRDLP 208
           I LE+HRDLP
Sbjct: 120 IKLEIHRDLP 129


>AY569705-1|AAS86658.1|  419|Apis mellifera complementary sex
           determiner protein.
          Length = 419

 Score = 21.0 bits (42), Expect = 7.0
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = -1

Query: 237 IILELHRDLP 208
           I LE+HRDLP
Sbjct: 131 IKLEIHRDLP 140


>AY569704-1|AAS86657.1|  426|Apis mellifera complementary sex
           determiner protein.
          Length = 426

 Score = 21.0 bits (42), Expect = 7.0
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = -1

Query: 237 IILELHRDLP 208
           I LE+HRDLP
Sbjct: 131 IKLEIHRDLP 140


>AY569703-1|AAS86656.1|  396|Apis mellifera complementary sex
           determiner protein.
          Length = 396

 Score = 21.0 bits (42), Expect = 7.0
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = -1

Query: 237 IILELHRDLP 208
           I LE+HRDLP
Sbjct: 120 IKLEIHRDLP 129


>AY569701-1|AAS86654.1|  407|Apis mellifera complementary sex
           determiner protein.
          Length = 407

 Score = 21.0 bits (42), Expect = 7.0
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = -1

Query: 237 IILELHRDLP 208
           I LE+HRDLP
Sbjct: 131 IKLEIHRDLP 140


>AY569700-1|AAS86653.1|  407|Apis mellifera complementary sex
           determiner protein.
          Length = 407

 Score = 21.0 bits (42), Expect = 7.0
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = -1

Query: 237 IILELHRDLP 208
           I LE+HRDLP
Sbjct: 131 IKLEIHRDLP 140


>AY569699-1|AAS86652.1|  396|Apis mellifera complementary sex
           determiner protein.
          Length = 396

 Score = 21.0 bits (42), Expect = 7.0
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = -1

Query: 237 IILELHRDLP 208
           I LE+HRDLP
Sbjct: 120 IKLEIHRDLP 129


>AY569698-1|AAS86651.1|  407|Apis mellifera complementary sex
           determiner protein.
          Length = 407

 Score = 21.0 bits (42), Expect = 7.0
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = -1

Query: 237 IILELHRDLP 208
           I LE+HRDLP
Sbjct: 131 IKLEIHRDLP 140


>AY569697-1|AAS86650.1|  413|Apis mellifera complementary sex
           determiner protein.
          Length = 413

 Score = 21.0 bits (42), Expect = 7.0
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = -1

Query: 237 IILELHRDLP 208
           I LE+HRDLP
Sbjct: 131 IKLEIHRDLP 140


>AY569696-1|AAS86649.1|  414|Apis mellifera complementary sex
           determiner protein.
          Length = 414

 Score = 21.0 bits (42), Expect = 7.0
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = -1

Query: 237 IILELHRDLP 208
           I LE+HRDLP
Sbjct: 131 IKLEIHRDLP 140


>AY569695-1|AAS86648.1|  414|Apis mellifera complementary sex
           determiner protein.
          Length = 414

 Score = 21.0 bits (42), Expect = 7.0
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = -1

Query: 237 IILELHRDLP 208
           I LE+HRDLP
Sbjct: 131 IKLEIHRDLP 140


>AY569694-1|AAS86647.1|  400|Apis mellifera complementary sex
           determiner protein.
          Length = 400

 Score = 21.0 bits (42), Expect = 7.0
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = -1

Query: 237 IILELHRDLP 208
           I LE+HRDLP
Sbjct: 120 IKLEIHRDLP 129


>AY352277-1|AAQ67418.1|  418|Apis mellifera complementary sex
           determiner protein.
          Length = 418

 Score = 21.0 bits (42), Expect = 7.0
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = -1

Query: 237 IILELHRDLP 208
           I LE+HRDLP
Sbjct: 136 IKLEIHRDLP 145


>AY352276-1|AAQ67417.1|  385|Apis mellifera complementary sex
           determiner protein.
          Length = 385

 Score = 21.0 bits (42), Expect = 7.0
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = -1

Query: 237 IILELHRDLP 208
           I LE+HRDLP
Sbjct: 131 IKLEIHRDLP 140


>AY350618-1|AAQ57660.1|  425|Apis mellifera complementary sex
           determiner protein.
          Length = 425

 Score = 21.0 bits (42), Expect = 7.0
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = -1

Query: 237 IILELHRDLP 208
           I LE+HRDLP
Sbjct: 131 IKLEIHRDLP 140


>AY350617-1|AAQ57659.1|  428|Apis mellifera complementary sex
           determiner protein.
          Length = 428

 Score = 21.0 bits (42), Expect = 7.0
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = -1

Query: 237 IILELHRDLP 208
           I LE+HRDLP
Sbjct: 131 IKLEIHRDLP 140


>AY350615-1|AAQ57657.1|  410|Apis mellifera complementary sex
           determiner protein.
          Length = 410

 Score = 21.0 bits (42), Expect = 7.0
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = -1

Query: 237 IILELHRDLP 208
           I LE+HRDLP
Sbjct: 131 IKLEIHRDLP 140


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 143,154
Number of Sequences: 438
Number of extensions: 3120
Number of successful extensions: 33
Number of sequences better than 10.0: 33
Number of HSP's better than 10.0 without gapping: 33
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 33
length of database: 146,343
effective HSP length: 53
effective length of database: 123,129
effective search space used: 13421061
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -