BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32288 (516 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q5M4L8 Cluster: Putative uncharacterized protein; n=1; ... 33 3.9 UniRef50_Q22B64 Cluster: Cyclic nucleotide-binding domain contai... 32 8.9 >UniRef50_Q5M4L8 Cluster: Putative uncharacterized protein; n=1; Streptococcus thermophilus LMG 18311|Rep: Putative uncharacterized protein - Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) Length = 81 Score = 33.1 bits (72), Expect = 3.9 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = -1 Query: 387 PSYLITLSIKKKTHQNPLRSLKDLSIHRERYRDR 286 P+Y+IT S KKKT++ P + LK + Y+++ Sbjct: 47 PTYIITNSFKKKTNKTPSKELKKAIKRKSNYKNK 80 >UniRef50_Q22B64 Cluster: Cyclic nucleotide-binding domain containing protein; n=1; Tetrahymena thermophila SB210|Rep: Cyclic nucleotide-binding domain containing protein - Tetrahymena thermophila SB210 Length = 1336 Score = 31.9 bits (69), Expect = 8.9 Identities = 18/69 (26%), Positives = 29/69 (42%) Frame = +3 Query: 63 VNVSVNTGYYKL*METLLTLWFNEWKTIFCMWFHTND*TRIHLNEKYIYIIEFHRCNCCV 242 V + + Y+K +T ++EW+ I W ND E+YI I F + C Sbjct: 384 VRMRIYEKYFKEKFKTNFITIYSEWQGIQNNWLRQNDLLNTSAGEQYINSIYFTMISMCT 443 Query: 243 IFT*SLHSI 269 I +H + Sbjct: 444 IGYGDIHPL 452 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 455,579,222 Number of Sequences: 1657284 Number of extensions: 8399254 Number of successful extensions: 18910 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17543 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18904 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 31782822356 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -