SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= epV32254
         (300 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ026039-1|AAY87898.1|  427|Apis mellifera nicotinic acetylcholi...    20   5.7  
Y13429-1|CAA73841.1|  402|Apis mellifera dopamine receptor, D1 p...    20   7.6  
AF274024-1|AAF90150.1|  232|Apis mellifera tetraspanin F139 prot...    20   7.6  

>DQ026039-1|AAY87898.1|  427|Apis mellifera nicotinic acetylcholine
           receptor beta2subunit protein.
          Length = 427

 Score = 20.2 bits (40), Expect = 5.7
 Identities = 11/49 (22%), Positives = 20/49 (40%)
 Frame = -3

Query: 181 RLH*KYREWNISTVPVILKSF*LKTPWF*KSNTIYLFKKRFSVLVTRFC 35
           R H         T+ ++L +  L T W   S+T  +     + ++  FC
Sbjct: 240 RRHYSMNSTTYVTLTIVLMTMTLMTLWLEPSSTERMIIANLNFILHLFC 288


>Y13429-1|CAA73841.1|  402|Apis mellifera dopamine receptor, D1
           protein.
          Length = 402

 Score = 19.8 bits (39), Expect = 7.6
 Identities = 5/10 (50%), Positives = 9/10 (90%)
 Frame = -3

Query: 52  LVTRFCQTCL 23
           +VT +C+TC+
Sbjct: 293 IVTSYCKTCI 302


>AF274024-1|AAF90150.1|  232|Apis mellifera tetraspanin F139
           protein.
          Length = 232

 Score = 19.8 bits (39), Expect = 7.6
 Identities = 7/14 (50%), Positives = 11/14 (78%)
 Frame = +2

Query: 251 N*SQKFQHIVSGYW 292
           N S+K+Q I +GY+
Sbjct: 114 NISEKYQEIFNGYF 127


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 85,993
Number of Sequences: 438
Number of extensions: 1527
Number of successful extensions: 7
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 49
effective length of database: 124,881
effective search space used:  6244050
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 38 (20.3 bits)

- SilkBase 1999-2023 -