BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32247 (446 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcript... 25 1.6 AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol ... 24 2.1 AJ276486-1|CAB90818.1| 364|Anopheles gambiae serine protease pr... 24 2.1 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 23 4.9 AF513637-1|AAM53609.1| 214|Anopheles gambiae glutathione S-tran... 22 8.6 AF045250-1|AAC02700.1| 259|Anopheles gambiae serine proteinase ... 22 8.6 >AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcriptase protein. Length = 1009 Score = 24.6 bits (51), Expect = 1.6 Identities = 8/27 (29%), Positives = 15/27 (55%) Frame = -2 Query: 310 TTLHGWRKSWKVDLYM*W*TXIIPHLN 230 TT+ W++ W ++ W +IP +N Sbjct: 849 TTMERWQREWDESVHGRWTYRLIPDVN 875 >AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol kinase protein. Length = 555 Score = 24.2 bits (50), Expect = 2.1 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = +2 Query: 275 NLPALSPTMESGSIVSWEKKEGDKLSEGDLLCEIETDK 388 ++ A+ T + + V W+K G+ L + +I TDK Sbjct: 81 DIAAIGITNQRETTVVWDKNTGEPLYNAIVWNDIRTDK 118 >AJ276486-1|CAB90818.1| 364|Anopheles gambiae serine protease protein. Length = 364 Score = 24.2 bits (50), Expect = 2.1 Identities = 11/24 (45%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = -3 Query: 264 CDGRL--E*YLIXTVHCGVDRTVW 199 C G L E Y+I HC VD+ W Sbjct: 137 CGGALISERYVITAAHCTVDKPNW 160 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 23.0 bits (47), Expect = 4.9 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -2 Query: 295 WRKSWKVDLY 266 WRKSW V +Y Sbjct: 597 WRKSWMVPIY 606 >AF513637-1|AAM53609.1| 214|Anopheles gambiae glutathione S-transferase D11 protein. Length = 214 Score = 22.2 bits (45), Expect = 8.6 Identities = 8/26 (30%), Positives = 12/26 (46%) Frame = +2 Query: 257 PSHIKVNLPALSPTMESGSIVSWEKK 334 P +K+N PT+ V WE + Sbjct: 41 PEFLKINPQHTVPTLVDNDFVLWESR 66 >AF045250-1|AAC02700.1| 259|Anopheles gambiae serine proteinase protein. Length = 259 Score = 22.2 bits (45), Expect = 8.6 Identities = 13/32 (40%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = +2 Query: 308 GSIV-SWEKKEGDKLSEGDLLCEIETDKATMG 400 GSI +WE DKL + +L+ E D T+G Sbjct: 156 GSISKTWEDIYPDKLMKVNLILRTEEDCQTIG 187 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 441,986 Number of Sequences: 2352 Number of extensions: 8430 Number of successful extensions: 14 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 37843779 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -