BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32246 (365 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0518 + 18486315-18486462,18486495-18486712,18486763-184868... 29 0.85 03_05_1143 + 30709825-30709926,30710105-30710260,30710356-307104... 27 4.5 >10_08_0518 + 18486315-18486462,18486495-18486712,18486763-18486808, 18487436-18487709,18487797-18488052 Length = 313 Score = 29.5 bits (63), Expect = 0.85 Identities = 22/55 (40%), Positives = 29/55 (52%), Gaps = 4/55 (7%) Frame = +1 Query: 34 LAICLSLTVALAAETGKYTPFQYNRVYS---TVSPFVYK-PGRYVADPGRYDPRR 186 LAI +L V + Y+ Q ++YS TV V + PGR AD G+YD RR Sbjct: 112 LAILDALAVPKVSSFESYSCMQTVKLYSLIVTVEELVLQQPGRAEADFGKYDIRR 166 >03_05_1143 + 30709825-30709926,30710105-30710260,30710356-30710439, 30710769-30710882,30711019-30711111,30711888-30711977, 30712157-30712227,30712300-30712374,30712481-30712568, 30712748-30712806,30712893-30712956,30713030-30713095, 30713283-30713435,30713522-30713626,30713739-30713974, 30714104-30714173,30714286-30714339,30714501-30714557, 30714662-30714741,30716056-30717919 Length = 1226 Score = 27.1 bits (57), Expect = 4.5 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 3/38 (7%) Frame = -3 Query: 129 WRNSRVNSVVLERSVLS---SFGGQRHCQRQADCQKDT 25 W+++ V V+ R + S S GQ+ C RQ CQ T Sbjct: 28 WKDNNVQVVIRVRPLSSGEISVQGQKRCVRQDSCQSIT 65 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,572,535 Number of Sequences: 37544 Number of extensions: 114151 Number of successful extensions: 309 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 305 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 309 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 564709324 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -