BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32246 (365 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC006417-1|AAH06417.2| 580|Homo sapiens XRN2 protein protein. 29 6.0 AY382900-1|AAR24369.1| 907|Homo sapiens 5'-3' exoribonuclease 2... 29 6.0 AL158013-2|CAH71495.1| 950|Homo sapiens 5'-3' exoribonuclease 2... 29 6.0 AL117332-2|CAI19756.1| 950|Homo sapiens 5'-3' exoribonuclease 2... 29 6.0 AK000084-1|BAA90934.1| 560|Homo sapiens protein ( Homo sapiens ... 29 6.0 AF152169-1|AAQ13577.1| 950|Homo sapiens DHP protein protein. 29 6.0 AF064257-1|AAD55138.1| 950|Homo sapiens Dhm1-like protein protein. 29 6.0 >BC006417-1|AAH06417.2| 580|Homo sapiens XRN2 protein protein. Length = 580 Score = 28.7 bits (61), Expect = 6.0 Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 2/35 (5%) Frame = +1 Query: 100 YNRVYSTVSPFVYKPGRY--VADPGRYDPRRDNSG 198 +NR+ T + ++P +Y +A PG Y PRRD+ G Sbjct: 523 WNRMLQTQNA-AFQPNQYQMLAGPGGYPPRRDDRG 556 >AY382900-1|AAR24369.1| 907|Homo sapiens 5'-3' exoribonuclease 2 isoform 3 protein. Length = 907 Score = 28.7 bits (61), Expect = 6.0 Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 2/35 (5%) Frame = +1 Query: 100 YNRVYSTVSPFVYKPGRY--VADPGRYDPRRDNSG 198 +NR+ T + ++P +Y +A PG Y PRRD+ G Sbjct: 850 WNRMLQTQNA-AFQPNQYQMLAGPGGYPPRRDDRG 883 >AL158013-2|CAH71495.1| 950|Homo sapiens 5'-3' exoribonuclease 2 protein. Length = 950 Score = 28.7 bits (61), Expect = 6.0 Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 2/35 (5%) Frame = +1 Query: 100 YNRVYSTVSPFVYKPGRY--VADPGRYDPRRDNSG 198 +NR+ T + ++P +Y +A PG Y PRRD+ G Sbjct: 893 WNRMLQTQNA-AFQPNQYQMLAGPGGYPPRRDDRG 926 >AL117332-2|CAI19756.1| 950|Homo sapiens 5'-3' exoribonuclease 2 protein. Length = 950 Score = 28.7 bits (61), Expect = 6.0 Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 2/35 (5%) Frame = +1 Query: 100 YNRVYSTVSPFVYKPGRY--VADPGRYDPRRDNSG 198 +NR+ T + ++P +Y +A PG Y PRRD+ G Sbjct: 893 WNRMLQTQNA-AFQPNQYQMLAGPGGYPPRRDDRG 926 >AK000084-1|BAA90934.1| 560|Homo sapiens protein ( Homo sapiens cDNA FLJ20077 fis, clone COL02904. ). Length = 560 Score = 28.7 bits (61), Expect = 6.0 Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 2/35 (5%) Frame = +1 Query: 100 YNRVYSTVSPFVYKPGRY--VADPGRYDPRRDNSG 198 +NR+ T + ++P +Y +A PG Y PRRD+ G Sbjct: 503 WNRMLQTQNA-AFQPNQYQMLAGPGGYPPRRDDRG 536 >AF152169-1|AAQ13577.1| 950|Homo sapiens DHP protein protein. Length = 950 Score = 28.7 bits (61), Expect = 6.0 Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 2/35 (5%) Frame = +1 Query: 100 YNRVYSTVSPFVYKPGRY--VADPGRYDPRRDNSG 198 +NR+ T + ++P +Y +A PG Y PRRD+ G Sbjct: 893 WNRMLQTQNA-AFQPNQYQMLAGPGGYPPRRDDRG 926 >AF064257-1|AAD55138.1| 950|Homo sapiens Dhm1-like protein protein. Length = 950 Score = 28.7 bits (61), Expect = 6.0 Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 2/35 (5%) Frame = +1 Query: 100 YNRVYSTVSPFVYKPGRY--VADPGRYDPRRDNSG 198 +NR+ T + ++P +Y +A PG Y PRRD+ G Sbjct: 893 WNRMLQTQNA-AFQPNQYQMLAGPGGYPPRRDDRG 926 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 40,981,824 Number of Sequences: 237096 Number of extensions: 626935 Number of successful extensions: 2603 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2595 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2603 length of database: 76,859,062 effective HSP length: 81 effective length of database: 57,654,286 effective search space used: 2306171440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -