BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32236 (348 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1486 + 26899479-26899549,26899861-26899989,26900649-269008... 32 0.11 11_06_0086 + 19914234-19914382,19914590-19914653,19914793-199148... 26 9.3 >07_03_1486 + 26899479-26899549,26899861-26899989,26900649-26900834, 26901025-26901247,26901662-26901666,26901796-26901924, 26902697-26902894,26903138-26903356,26903461-26903699, 26903797-26903888,26904009-26904224,26904327-26904554, 26904631-26904722,26904806-26904899,26905475-26905567, 26905667-26906640,26906727-26906841,26907135-26908895 Length = 1687 Score = 32.3 bits (70), Expect = 0.11 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = +3 Query: 72 EVLCACRISNFASILNVA*ETIYLFICLLSXEFFYLFKEELVIMFS 209 EV ACR+ NF + +A + YL CL+ F L ++ L + S Sbjct: 673 EVARACRMGNFIAFFRLARKATYLQACLMHAHFAKLRRQALASLHS 718 >11_06_0086 + 19914234-19914382,19914590-19914653,19914793-19914882, 19915000-19915056,19915147-19915195,19915393-19915469, 19915686-19915725,19915813-19915907,19916007-19916171, 19916317-19916427,19916515-19916602,19916691-19916757, 19916822-19916939,19917022-19917139,19917398-19917643, 19917736-19917833,19917961-19918143,19918237-19918356, 19918515-19918565 Length = 661 Score = 25.8 bits (54), Expect = 9.3 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -3 Query: 292 YTTNYTRVLKLIVRGEIVEKFGNI 221 Y NY+R+ K + ++ K GN+ Sbjct: 347 YAYNYSRITKSVTLSSLISKLGNL 370 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,664,155 Number of Sequences: 37544 Number of extensions: 80057 Number of successful extensions: 93 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 93 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 93 length of database: 14,793,348 effective HSP length: 73 effective length of database: 12,052,636 effective search space used: 506210712 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -