BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32236 (348 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 22 1.8 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 21 4.2 U66709-1|AAB07515.1| 182|Apis mellifera ankyrin protein. 20 7.3 U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 20 7.3 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 20 7.3 AF091732-1|AAD02869.2| 154|Apis mellifera long-wavelength rhodo... 20 7.3 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 20 9.6 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 20 9.6 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 20 9.6 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 22.2 bits (45), Expect = 1.8 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +1 Query: 85 HAGYLILHQSSMWPEKLFIYLFVY 156 H GYLI + + LF+ +F Y Sbjct: 203 HLGYLIFSSTISFYLPLFVMVFTY 226 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 21.0 bits (42), Expect = 4.2 Identities = 11/53 (20%), Positives = 24/53 (45%) Frame = +3 Query: 153 LLSXEFFYLFKEELVIMFSYYI*MLPNFSTISPLTISFKTLV*FVVYKL*YIK 311 LLS F+L E++ S + +L + + + + ++ V+ + Y K Sbjct: 274 LLSQTMFFLLISEIIPSTSLALPLLGKYLLFTMILVGLSVVITIVILNVHYRK 326 >U66709-1|AAB07515.1| 182|Apis mellifera ankyrin protein. Length = 182 Score = 20.2 bits (40), Expect = 7.3 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +1 Query: 145 LFVY*VXNFFIYLKR 189 LFV + NF IY KR Sbjct: 141 LFVPYITNFIIYSKR 155 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 20.2 bits (40), Expect = 7.3 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +1 Query: 223 CYQIFQQFLPLQLVL 267 CY I+ F+PL L++ Sbjct: 219 CYGIWVYFVPLFLII 233 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 20.2 bits (40), Expect = 7.3 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -2 Query: 74 FGDLINGKTXXPP 36 FGD+ GK PP Sbjct: 644 FGDVCRGKLKLPP 656 >AF091732-1|AAD02869.2| 154|Apis mellifera long-wavelength rhodopsin protein. Length = 154 Score = 20.2 bits (40), Expect = 7.3 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +1 Query: 223 CYQIFQQFLPLQLVL 267 CY I+ F+PL L++ Sbjct: 95 CYGIWVYFVPLFLII 109 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 19.8 bits (39), Expect = 9.6 Identities = 8/27 (29%), Positives = 14/27 (51%) Frame = -3 Query: 304 YYSLYTTNYTRVLKLIVRGEIVEKFGN 224 Y + +TR+ I G +V+ +GN Sbjct: 322 YVQMIHDLHTRISTAIDLGYVVDSYGN 348 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 19.8 bits (39), Expect = 9.6 Identities = 13/46 (28%), Positives = 21/46 (45%) Frame = +3 Query: 153 LLSXEFFYLFKEELVIMFSYYI*MLPNFSTISPLTISFKTLV*FVV 290 LLS F+L E++ S + +L F + + +F V VV Sbjct: 279 LLSLTVFFLLLAEIIPPTSLVVPLLGKFVLFTMILDTFSICVTVVV 324 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 19.8 bits (39), Expect = 9.6 Identities = 8/27 (29%), Positives = 14/27 (51%) Frame = -3 Query: 304 YYSLYTTNYTRVLKLIVRGEIVEKFGN 224 Y + +TR+ I G +V+ +GN Sbjct: 322 YVQMIHDLHTRISTAIDLGYVVDSYGN 348 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 67,072 Number of Sequences: 438 Number of extensions: 1072 Number of successful extensions: 9 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 7936320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -