BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32232 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g17890.1 68418.m02098 LIM domain-containing protein / disease... 31 0.35 At2g23140.1 68415.m02763 armadillo/beta-catenin repeat family pr... 31 0.61 At5g66610.1 68418.m08396 LIM domain-containing protein contains ... 30 1.1 At5g60250.1 68418.m07552 zinc finger (C3HC4-type RING finger) fa... 29 1.4 At3g09000.1 68416.m01053 proline-rich family protein 29 1.4 At4g36860.1 68417.m05226 LIM domain-containing protein low simil... 28 3.2 At5g52950.1 68418.m06570 expressed protein ; expression supporte... 28 4.3 At2g43690.1 68415.m05431 lectin protein kinase, putative similar... 28 4.3 At5g66630.1 68418.m08398 LIM domain-containing protein contains ... 27 7.5 At5g15530.1 68418.m01818 biotin carboxyl carrier protein 2 (BCCP... 27 7.5 At5g07350.1 68418.m00839 tudor domain-containing protein / nucle... 27 7.5 At4g33590.1 68417.m04772 hypothetical protein 27 7.5 At5g14890.1 68418.m01746 NHL repeat-containing protein contains ... 27 9.9 At4g39050.1 68417.m05531 kinesin-related protein (MKRP2) kinesin... 27 9.9 At3g57520.3 68416.m06405 alkaline alpha galactosidase, putative ... 27 9.9 At3g57520.2 68416.m06404 alkaline alpha galactosidase, putative ... 27 9.9 At3g57520.1 68416.m06403 alkaline alpha galactosidase, putative ... 27 9.9 At1g66680.1 68414.m07579 S locus-linked protein, putative simila... 27 9.9 At1g19270.1 68414.m02397 ubiquitin interaction motif-containing ... 27 9.9 >At5g17890.1 68418.m02098 LIM domain-containing protein / disease resistance protein-related low similarity to disease resistance protein RPP4 [Arabidopsis thaliana] GI:20270890; contains Pfam profiles PF00412: LIM domain, PF00931: NB-ARC domain, PF00560: Leucine Rich Repeat Length = 1613 Score = 31.5 bits (68), Expect = 0.35 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +2 Query: 182 TRCKGCGNPIVDK-AIIALDAKWHRDCFTCMADRSNIRIVE 301 ++CK C + I D +I A + WH CF C+ R I + E Sbjct: 1238 SKCKDCKSAIEDGISINAYGSVWHPQCFCCLRCREPIAMNE 1278 >At2g23140.1 68415.m02763 armadillo/beta-catenin repeat family protein / U-box domain-containing protein contains Pfam domain, PF00514: Armadillo/beta-catenin-like repeats and Pfam, PF04564: U-box domain Length = 811 Score = 30.7 bits (66), Expect = 0.61 Identities = 28/109 (25%), Positives = 52/109 (47%), Gaps = 4/109 (3%) Frame = +3 Query: 33 SLTV*SKLLACRGTLTTSSA-VDARRSLAVEGSWNRLAVPIAPTATQTSSP-LAARGAEI 206 SL S LL+C ++ ++ A V AR+ W+ ++++T P ++R E Sbjct: 312 SLNELSPLLSCTDSIPSTGADVSARKVSNKSHDWDA-------SSSETGKPSFSSRATER 364 Query: 207 Q--SSIKPSSRLMLSGTAIASRAWRIEATFGSLREKVQESSDRFDILRD 347 + S +P+S L S I+ + ++A GSL + S+D ++ D Sbjct: 365 EGASPSRPASALGASSPGISGNGYGLDARRGSLNDFEDRSNDSRELRTD 413 >At5g66610.1 68418.m08396 LIM domain-containing protein contains Pfam profile PF00412: LIM domain Length = 529 Score = 29.9 bits (64), Expect = 1.1 Identities = 11/28 (39%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = +2 Query: 188 CKGCGNPI-VDKAIIALDAKWHRDCFTC 268 C GC + I +++ AL WH +CF C Sbjct: 201 CDGCKSAIEYGRSVHALGVNWHPECFCC 228 >At5g60250.1 68418.m07552 zinc finger (C3HC4-type RING finger) family protein contains a Prosite:PS00518 Zinc finger, C3HC4 type (RING finger), signature and Pfam domain PF01485: IBR domain Length = 655 Score = 29.5 bits (63), Expect = 1.4 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +2 Query: 188 CKGCGNPIVDKAIIALDAKWHRDCFTCMADRSNIRIV 298 C C N IV + + ++D HR CF C+ ++++ Sbjct: 301 CAICFNDIVAEGMFSVDKCRHRFCFQCVKQHVEVKLL 337 >At3g09000.1 68416.m01053 proline-rich family protein Length = 541 Score = 29.5 bits (63), Expect = 1.4 Identities = 23/76 (30%), Positives = 34/76 (44%) Frame = +3 Query: 3 PAVPWXAATPSLTV*SKLLACRGTLTTSSAVDARRSLAVEGSWNRLAVPIAPTATQTSSP 182 PA P +T T S+ + R + + SS +R +L + A AP T TSS Sbjct: 159 PATPTRRSTTPTTSTSRPVTTRASNSRSSTPTSRATLTAARATTSTA---APRTTTTSSG 215 Query: 183 LAARGAEIQSSIKPSS 230 A +S+ +PSS Sbjct: 216 SARSATPTRSNPRPSS 231 >At4g36860.1 68417.m05226 LIM domain-containing protein low similarity to LIM-domain protein [Branchiostoma floridae] GI:3360516, DRAL/Slim3/FHL2 [Homo sapiens] GI:7209525; contains Pfam profile PF00412: LIM domain Length = 351 Score = 28.3 bits (60), Expect = 3.2 Identities = 13/50 (26%), Positives = 17/50 (34%) Frame = +2 Query: 56 LGVSWHAHHFVXXXXXXXXXXXXFMEQAGRPYCSDCYADKFATRCKGCGN 205 +G WH F F RPY CY ++ +C C N Sbjct: 1 MGGVWHPECFCCNACDKPIIDYEFSMSGNRPYHKLCYKEQHHPKCDVCHN 50 >At5g52950.1 68418.m06570 expressed protein ; expression supported by MPSS Length = 945 Score = 27.9 bits (59), Expect = 4.3 Identities = 14/53 (26%), Positives = 23/53 (43%) Frame = -3 Query: 265 REAIAVPLSIKRDDGFIDDWISAPLAASGELVCVAVGAIGTASLFHEPSTAKL 107 RE + +S +G + I P S L+CV + ++ HE S K+ Sbjct: 424 REGFSALVSFSNSNGSLRTGILKPFTFSSALICVFDNGVSPQTVDHEDSRKKV 476 >At2g43690.1 68415.m05431 lectin protein kinase, putative similar to receptor-like kinase LECRK1 [Arabidopsis thaliana] gi|2150023|gb|AAB58725 Length = 664 Score = 27.9 bits (59), Expect = 4.3 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = +3 Query: 288 FGSLREKVQESSDRFDILRDGKPATLR*MRLIHHKYINKIPHRDV 422 +G+ +K S RF I++D A + +HH +I+ + HRD+ Sbjct: 422 YGTSDQKQLSWSQRFKIIKDVASA----LSYLHHGWIHVVIHRDI 462 >At5g66630.1 68418.m08398 LIM domain-containing protein contains low similarity to Pfam profile PF00412: LIM domain Length = 702 Score = 27.1 bits (57), Expect = 7.5 Identities = 12/39 (30%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +2 Query: 188 CKGCGNPIV-DKAIIALDAKWHRDCFTCMADRSNIRIVE 301 C GC + + ++++ L WH CF C + I I E Sbjct: 347 CGGCNSAVKHEESVNILGVLWHPGCFCCRSCDKPIAIHE 385 >At5g15530.1 68418.m01818 biotin carboxyl carrier protein 2 (BCCP2) identical to biotin carboxyl carrier protein isoform 2 [Arabidopsis thaliana] gi|8886869|gb|AAF80592 Length = 255 Score = 27.1 bits (57), Expect = 7.5 Identities = 18/58 (31%), Positives = 28/58 (48%) Frame = +3 Query: 144 VPIAPTATQTSSPLAARGAEIQSSIKPSSRLMLSGTAIASRAWRIEATFGSLREKVQE 317 V + P+ T TS+P A+ SS P + ++GT S E F + +KVQ+ Sbjct: 153 VALPPSPTPTSTPATAKPTSAPSSSHPPLKSPMAGTFYRSPG-PGEPPFVKVGDKVQK 209 >At5g07350.1 68418.m00839 tudor domain-containing protein / nuclease family protein contains Pfam domains PF00567: Tudor domain and PF00565: Staphylococcal nuclease homologue Length = 991 Score = 27.1 bits (57), Expect = 7.5 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 4/54 (7%) Frame = -2 Query: 203 FRTPCSEWRTCLRSSRSNRDGQP----VP*TLHRQAPSCIHRRRSGERATTRQE 54 F +P +E R CL S RS + G P P R+A + +R G++ + E Sbjct: 402 FGSPAAERRVCLSSIRSPKMGNPRREEKPAPYAREAREFLRQRLIGKQVIVQME 455 >At4g33590.1 68417.m04772 hypothetical protein Length = 466 Score = 27.1 bits (57), Expect = 7.5 Identities = 9/25 (36%), Positives = 17/25 (68%), Gaps = 2/25 (8%) Frame = -1 Query: 363 EWLVFHHGECR--IGHWIPALFLST 295 +W+++H GE R +GHW+ + +T Sbjct: 199 KWVLYHWGELRFGMGHWLSEIVTAT 223 >At5g14890.1 68418.m01746 NHL repeat-containing protein contains Pfam profile PF01436: NHL repeat Length = 754 Score = 26.6 bits (56), Expect = 9.9 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = -1 Query: 312 ALFLSTIRMLLLSAMHVKQSRCHLASSAMMALSTIGFPHPLQR 184 AL + +R L S+ H +S+ H+A+ +M +P P+++ Sbjct: 266 ALLVRRVRSLFSSSSHDTKSKRHVATPSMTMAPYQRYPRPVRQ 308 >At4g39050.1 68417.m05531 kinesin-related protein (MKRP2) kinesin motor protein - Ustilago maydis, PID:g2062750; identical to cDNA MKRP2 mRNA for kinesin-related protein GI:16902293, kinesin-related protein [Arabidopsis thaliana] GI:16902294 Length = 1055 Score = 26.6 bits (56), Expect = 9.9 Identities = 20/60 (33%), Positives = 30/60 (50%) Frame = +3 Query: 111 LAVEGSWNRLAVPIAPTATQTSSPLAARGAEIQSSIKPSSRLMLSGTAIASRAWRIEATF 290 +A S R + P +P ++ +SS L+ R +S SS L+ S IASR+ TF Sbjct: 1 MASSSSRTRSSRPPSPASSTSSSHLSNRLIPRSNSTSASS-LITSAAGIASRSMTPSRTF 59 >At3g57520.3 68416.m06405 alkaline alpha galactosidase, putative similar to alkaline alpha galactosidase II [Cucumis melo] GI:29838631; contains Pfam profile PF05691: Raffinose synthase or seed imbibition protein Sip1 Length = 565 Score = 26.6 bits (56), Expect = 9.9 Identities = 12/45 (26%), Positives = 23/45 (51%) Frame = +3 Query: 276 IEATFGSLREKVQESSDRFDILRDGKPATLR*MRLIHHKYINKIP 410 +E + G+ V ++ F+++R A R M+ HH+ K+P Sbjct: 150 VETSQGTHLVYVHAGTNPFEVIRQSVKAVERHMQTFHHREKKKLP 194 >At3g57520.2 68416.m06404 alkaline alpha galactosidase, putative similar to alkaline alpha galactosidase II [Cucumis melo] GI:29838631; contains Pfam profile PF05691: Raffinose synthase or seed imbibition protein Sip1 Length = 656 Score = 26.6 bits (56), Expect = 9.9 Identities = 12/45 (26%), Positives = 23/45 (51%) Frame = +3 Query: 276 IEATFGSLREKVQESSDRFDILRDGKPATLR*MRLIHHKYINKIP 410 +E + G+ V ++ F+++R A R M+ HH+ K+P Sbjct: 150 VETSQGTHLVYVHAGTNPFEVIRQSVKAVERHMQTFHHREKKKLP 194 >At3g57520.1 68416.m06403 alkaline alpha galactosidase, putative similar to alkaline alpha galactosidase II [Cucumis melo] GI:29838631; contains Pfam profile PF05691: Raffinose synthase or seed imbibition protein Sip1 Length = 773 Score = 26.6 bits (56), Expect = 9.9 Identities = 12/45 (26%), Positives = 23/45 (51%) Frame = +3 Query: 276 IEATFGSLREKVQESSDRFDILRDGKPATLR*MRLIHHKYINKIP 410 +E + G+ V ++ F+++R A R M+ HH+ K+P Sbjct: 150 VETSQGTHLVYVHAGTNPFEVIRQSVKAVERHMQTFHHREKKKLP 194 >At1g66680.1 68414.m07579 S locus-linked protein, putative similar to S locus-linked protein SLL2 [Brassica napus] GI:1518113 Length = 358 Score = 26.6 bits (56), Expect = 9.9 Identities = 15/66 (22%), Positives = 30/66 (45%) Frame = +3 Query: 144 VPIAPTATQTSSPLAARGAEIQSSIKPSSRLMLSGTAIASRAWRIEATFGSLREKVQESS 323 + + P +T+ AR A ++ S +IA+ +W I++ +GS + Q + Sbjct: 4 IRLLPEEPETTPQQQARAAAAVTTTTTDSLASDDDRSIAADSWSIKSEYGSTLDDDQRHA 63 Query: 324 DRFDIL 341 D + L Sbjct: 64 DAAEAL 69 >At1g19270.1 68414.m02397 ubiquitin interaction motif-containing protein / LIM domain-containing protein weak similarity to LIM-homeobox protein [Mus musculus] GI:2149584, Hic-5 [Mus musculus] GI:664955; contains Pfam profiles PF02809: Ubiquitin interaction motif, PF00412: LIM domain Length = 532 Score = 26.6 bits (56), Expect = 9.9 Identities = 13/44 (29%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +2 Query: 188 CKGCGNPIVDKAII-ALDAKWHRDCFTCMADRSNIRIVERKSAG 316 C GC I + L++ WH +CF C I E ++G Sbjct: 172 CAGCNMEIGHGRFLNCLNSLWHPECFRCYGCSQPISEYEFSTSG 215 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,132,416 Number of Sequences: 28952 Number of extensions: 220358 Number of successful extensions: 632 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 621 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 632 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -