BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32231 (516 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-12|CAD27934.1| 160|Anopheles gambiae putative MLC1 pro... 186 5e-49 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 26 0.66 AY187043-1|AAO39757.1| 171|Anopheles gambiae putative antennal ... 23 4.6 AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-b... 23 4.6 AY146728-1|AAO12088.1| 131|Anopheles gambiae odorant-binding pr... 23 6.1 >AJ439353-12|CAD27934.1| 160|Anopheles gambiae putative MLC1 protein protein. Length = 160 Score = 186 bits (452), Expect = 5e-49 Identities = 86/142 (60%), Positives = 105/142 (73%) Frame = +2 Query: 32 DVERASFAFSIYDFEGKGKIDAFNLGDLLRALNSNPTLATIXXXXXXXXXXXXXXXXXXF 211 ++E+A F FS+YD+EG G++DA +LG+ LRALN NPT+ I F Sbjct: 9 EIEKAQFVFSVYDWEGSGQMDAMDLGNALRALNLNPTIELIGKMGGTQKRGEKKIKFEEF 68 Query: 212 LPIYSQAKKDKDQGAYEDFLECLKLYDKNENGLMLGAELTHTLLALGEKLDDSEVAEVTK 391 LPI+SQ KK+K+QG +EDFLECLKLYDKNE+G ML AELTH+L ALGE+LDD E+ V K Sbjct: 69 LPIFSQVKKEKEQGCFEDFLECLKLYDKNEDGTMLLAELTHSLTALGERLDDVELDNVMK 128 Query: 392 DCMDPEDDDGMIPYAAFLKKVM 457 DCMDPEDDDG IPYA FLKK+M Sbjct: 129 DCMDPEDDDGNIPYAPFLKKMM 150 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 26.2 bits (55), Expect = 0.66 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +2 Query: 350 GEKLDDSEVAEVTKDCMDPEDDDG 421 G K+++ +AEV K +D EDD G Sbjct: 1250 GLKMENGVIAEVEKSQVDGEDDTG 1273 Score = 23.0 bits (47), Expect = 6.1 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = -2 Query: 383 LQRLHCRQASHLVQEACV*AQRQA*DRFRSCHTASD 276 ++RL C + LV+E +R+ DRF H S+ Sbjct: 1783 IKRLSCAEICQLVKERARAKRREDVDRFDLQHADSN 1818 >AY187043-1|AAO39757.1| 171|Anopheles gambiae putative antennal carrier protein AP-1 protein. Length = 171 Score = 23.4 bits (48), Expect = 4.6 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = +2 Query: 320 AELTHTLLALGEKLDDSEVAEVTKDCMDP 406 AE ++ DD +VT++C+DP Sbjct: 64 AESFKCVIVKNSTKDDVNKVQVTRECLDP 92 >AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-binding protein OBPjj17 protein. Length = 285 Score = 23.4 bits (48), Expect = 4.6 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = -3 Query: 367 VVKLLT*CKKRVCELSAKHETVFVLVIQLQTFQEIF 260 V+K L+ CK +V +L +H + Q + ++IF Sbjct: 130 VLKALSYCKPKVTQLQGRHVRTDEEMEQCEIAEDIF 165 >AY146728-1|AAO12088.1| 131|Anopheles gambiae odorant-binding protein AgamOBP21 protein. Length = 131 Score = 23.0 bits (47), Expect = 6.1 Identities = 14/32 (43%), Positives = 17/32 (53%), Gaps = 3/32 (9%) Frame = +2 Query: 314 LGAELTH---TLLALGEKLDDSEVAEVTKDCM 400 LG EL T + LG+ DSE A+ T CM Sbjct: 35 LGGELPEDFATKMRLGDLTLDSETAKCTIQCM 66 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 466,921 Number of Sequences: 2352 Number of extensions: 8627 Number of successful extensions: 20 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -