BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32228 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g36305.1 68415.m04456 CAAX amino terminal protease family pro... 30 1.1 At3g45530.1 68416.m04917 DC1 domain-containing protein contains ... 27 5.7 At2g45240.1 68415.m05632 methionyl aminopeptidase, putative / me... 27 7.5 At1g68480.1 68414.m07823 zinc finger (C2H2 type) family protein ... 27 9.9 >At2g36305.1 68415.m04456 CAAX amino terminal protease family protein similar to CAAX prenyl protease 2 (EC 3.4.22.-) (Prenyl protein-specific endoprotease 2) (Farnesylated-proteins converting enzyme 2) (FACE-2) from Mus musculus [SP|P57791], Homo sapiens [SP|Q9Y256], Drosophila melanogaster [SP|Q9U1H8]; contains Pfam profile PF02517 CAAX amino terminal protease family protein Length = 242 Score = 29.9 bits (64), Expect = 1.1 Identities = 23/51 (45%), Positives = 29/51 (56%), Gaps = 4/51 (7%) Frame = -1 Query: 165 VNEVVVF---LVNAILSCGFRINEAILHLCYVNF-LQHFHIHKHFRVYFIR 25 V E +VF ++ +L GFRIN AI LC V F L H + HFR +IR Sbjct: 93 VTEELVFRSCMIPLLLCAGFRINTAIF-LCPVLFSLAHLN---HFREMYIR 139 >At3g45530.1 68416.m04917 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 692 Score = 27.5 bits (58), Expect = 5.7 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -2 Query: 77 IFCSTSIFINILGYTSYGAGTTKPW 3 ++CS + LGYT GA T PW Sbjct: 640 VYCSCYCVSSQLGYTYKGADTCPPW 664 >At2g45240.1 68415.m05632 methionyl aminopeptidase, putative / methionine aminopeptidase, putative / peptidase M, putative similar to SP|Q01662 Methionine aminopeptidase 1 precursor (EC 3.4.11.18) {Saccharomyces cerevisiae}; contains Pfam profile PF00557: metallopeptidase family M24 Length = 398 Score = 27.1 bits (57), Expect = 7.5 Identities = 11/33 (33%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = +1 Query: 400 KIPEFSWXSPIKTGYYPLMLTKXTP-XAQRPDY 495 K+P F W P+K YP+ + P ++PD+ Sbjct: 91 KLPHFDWTGPLK--QYPISTKRVVPAEIEKPDW 121 >At1g68480.1 68414.m07823 zinc finger (C2H2 type) family protein contains Pfam profile: PF00096 zinc finger, C2H2 type Length = 253 Score = 26.6 bits (56), Expect = 9.9 Identities = 11/45 (24%), Positives = 22/45 (48%) Frame = +1 Query: 61 EVLQKIYVTKMQDGLINPEAAAKYGIHKENDYFVYKANYSNAVLY 195 E L + ++ I P + +G H D +Y++ YS+ ++Y Sbjct: 80 ETLNQARQLVYRNDTITPPGISPFGYHHTTDPTIYRSVYSSPMIY 124 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,065,873 Number of Sequences: 28952 Number of extensions: 186510 Number of successful extensions: 489 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 482 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 489 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -