BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32224 (516 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 25 0.35 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 24 1.1 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 21 7.5 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 21 7.5 AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. 21 7.5 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 21 10.0 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 25.4 bits (53), Expect = 0.35 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +2 Query: 116 KIISTIQN*SRKHTYYILSNFNRMPYYK 199 KIIS++ N + Y +N+N+ YYK Sbjct: 80 KIISSLSNNYKYSNYNNYNNYNKKLYYK 107 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 23.8 bits (49), Expect = 1.1 Identities = 12/53 (22%), Positives = 24/53 (45%) Frame = +3 Query: 144 PENIPTIYYQILIECHITKKAHLKTDSTNTRRALTWIQAQKHSEKFTFNHRTS 302 P + P YQ++++C ++ H T + T+ I++ K N T+ Sbjct: 860 PMDCPEAIYQLMLDCWQKERTHRPTFANLTQTLDKLIRSPDTLRKIAQNRGTN 912 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.0 bits (42), Expect = 7.5 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +3 Query: 426 ISRTIIDINHKYVLNISR 479 I +TI+D HKY N+ + Sbjct: 420 IYKTILDYYHKYKENLPK 437 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.0 bits (42), Expect = 7.5 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +3 Query: 426 ISRTIIDINHKYVLNISR 479 I +TI+D HKY N+ + Sbjct: 420 IYKTILDYYHKYKENLPK 437 >AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. Length = 226 Score = 21.0 bits (42), Expect = 7.5 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +3 Query: 426 ISRTIIDINHKYVLNISR 479 I +TI+D HKY N+ + Sbjct: 46 IYKTILDYYHKYKENLPK 63 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 20.6 bits (41), Expect = 10.0 Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = +2 Query: 116 KIISTIQN*---SRKHTYYILSNFNRMPYYK 199 KIIS++ N + + Y +N+N+ YYK Sbjct: 313 KIISSLSNNYNYNNNNYKYNYNNYNKKLYYK 343 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,830 Number of Sequences: 438 Number of extensions: 2814 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14354847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -