BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32218 (516 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY255857-1|AAP13483.1| 216|Anopheles gambiae glutathione tranfe... 24 3.5 AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. 24 3.5 M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 23 8.1 >AY255857-1|AAP13483.1| 216|Anopheles gambiae glutathione tranferase d9 protein. Length = 216 Score = 23.8 bits (49), Expect = 3.5 Identities = 12/42 (28%), Positives = 23/42 (54%) Frame = +1 Query: 337 GIILMTMATTSGLSSYSSCLPVPVRKIQTSKKLVLECLRLYQ 462 G IL+ +A + + P P+R+ +++L+ EC LY+ Sbjct: 66 GAILIYLAEQYAPAGTTYYPPDPLRRAIVNQRLLFECGTLYK 107 >AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. Length = 1152 Score = 23.8 bits (49), Expect = 3.5 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = -3 Query: 445 ILIPASLMFGSCALAQVNM 389 + +P +L+FGS L Q+N+ Sbjct: 341 VSLPGTLLFGSANLTQLNL 359 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 22.6 bits (46), Expect = 8.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +3 Query: 303 RKVCDVVSELARNH 344 RK+ D V+ L RNH Sbjct: 822 RKIADAVTRLLRNH 835 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 525,648 Number of Sequences: 2352 Number of extensions: 10811 Number of successful extensions: 11 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -