BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32211 (444 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 25 0.43 AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory recept... 25 0.43 EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetyla... 22 2.3 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 6.9 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 6.9 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 6.9 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 6.9 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 20 9.2 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 24.6 bits (51), Expect = 0.43 Identities = 16/53 (30%), Positives = 28/53 (52%) Frame = -3 Query: 325 LVVQSERFPEFFXHGLSVLFNDELSGQSYELGEFQTTRFVGVDLLNKFLEDFL 167 LV+ SE+ F L ++FN LS ++ E+ +RF ++ +FL +L Sbjct: 154 LVIVSEQEWSFSTGLLVMIFNSALSYKASEIVVMLRSRFAILNKQIRFLNQYL 206 >AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory receptor candidate 3 protein. Length = 398 Score = 24.6 bits (51), Expect = 0.43 Identities = 16/53 (30%), Positives = 28/53 (52%) Frame = -3 Query: 325 LVVQSERFPEFFXHGLSVLFNDELSGQSYELGEFQTTRFVGVDLLNKFLEDFL 167 LV+ SE+ F L ++FN LS ++ E+ +RF ++ +FL +L Sbjct: 172 LVIVSEQEWSFSTGLLVMIFNSALSYKASEIVVMLRSRFAILNKQIRFLNQYL 224 >EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetylase 1 protein. Length = 534 Score = 22.2 bits (45), Expect = 2.3 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -3 Query: 160 WLPHHSQDISHEVTGDT 110 W+PH + S EV G+T Sbjct: 493 WVPHSCKLTSKEVPGET 509 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 20.6 bits (41), Expect = 6.9 Identities = 21/68 (30%), Positives = 32/68 (47%) Frame = -3 Query: 409 IEFIVSQLLVQFPEDLAQARRGNVTVAFLVVQSERFPEFFXHGLSVLFNDELSGQSYELG 230 +EF+ S +++ ED + ARR V +L V + EF H + F+D + Sbjct: 578 MEFLKS--ILRLDEDQS-ARR--VAQKYLRVVDPDYYEFETH---IFFDDAFEISDHNDD 629 Query: 229 EFQTTRFV 206 E Q RFV Sbjct: 630 ETQVNRFV 637 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 20.6 bits (41), Expect = 6.9 Identities = 21/68 (30%), Positives = 32/68 (47%) Frame = -3 Query: 409 IEFIVSQLLVQFPEDLAQARRGNVTVAFLVVQSERFPEFFXHGLSVLFNDELSGQSYELG 230 +EF+ S +++ ED + ARR V +L V + EF H + F+D + Sbjct: 578 MEFLKS--ILRLDEDQS-ARR--VAQKYLRVVDPDYYEFETH---IFFDDAFEISDHNDD 629 Query: 229 EFQTTRFV 206 E Q RFV Sbjct: 630 ETQVNRFV 637 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 20.6 bits (41), Expect = 6.9 Identities = 21/68 (30%), Positives = 32/68 (47%) Frame = -3 Query: 409 IEFIVSQLLVQFPEDLAQARRGNVTVAFLVVQSERFPEFFXHGLSVLFNDELSGQSYELG 230 +EF+ S +++ ED + ARR V +L V + EF H + F+D + Sbjct: 578 MEFLKS--ILRLDEDQS-ARR--VAQKYLRVVDPDYYEFETH---IFFDDAFEISDHNDD 629 Query: 229 EFQTTRFV 206 E Q RFV Sbjct: 630 ETQVNRFV 637 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 20.6 bits (41), Expect = 6.9 Identities = 21/68 (30%), Positives = 32/68 (47%) Frame = -3 Query: 409 IEFIVSQLLVQFPEDLAQARRGNVTVAFLVVQSERFPEFFXHGLSVLFNDELSGQSYELG 230 +EF+ S +++ ED + ARR V +L V + EF H + F+D + Sbjct: 578 MEFLKS--ILRLDEDQS-ARR--VAQKYLRVVDPDYYEFETH---IFFDDAFEISDHNDD 629 Query: 229 EFQTTRFV 206 E Q RFV Sbjct: 630 ETQVNRFV 637 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 20.2 bits (40), Expect = 9.2 Identities = 6/9 (66%), Positives = 8/9 (88%) Frame = -3 Query: 151 HHSQDISHE 125 HH Q++SHE Sbjct: 317 HHQQNMSHE 325 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 86,533 Number of Sequences: 336 Number of extensions: 1559 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 9985735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -