BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32204 (516 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle pr... 44 9e-07 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 22 4.3 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 22 4.3 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 22 4.3 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 21 7.5 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 21 7.5 >EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle protein protein. Length = 138 Score = 44.0 bits (99), Expect = 9e-07 Identities = 30/85 (35%), Positives = 41/85 (48%), Gaps = 1/85 (1%) Frame = +1 Query: 265 PSGAGYDYKYGIIRYDNDVAPEG-YHYLYETENKILAEEAGKVENVGTENEGIKVKGFYE 441 PSG G D I +V +G Y +ET N I +E+G+ + V E + +G Sbjct: 19 PSG-GADKDAVITSQQLEVNFDGNYINNFETSNGISHQESGQPKQVDNETPVVS-QGSDS 76 Query: 442 YVGPDGVTYRVDYTADENGFVADGA 516 Y PDG + Y ADENGF G+ Sbjct: 77 YTAPDGQQVSITYVADENGFQVQGS 101 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 4.3 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -1 Query: 177 HDGQGNNAGSLVSITKVFA 121 H G G N G + ITK+ A Sbjct: 148 HTGVGRNVGYKIPITKLTA 166 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 4.3 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -1 Query: 177 HDGQGNNAGSLVSITKVFA 121 H G G N G + ITK+ A Sbjct: 148 HTGVGRNVGYKIPITKLTA 166 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 4.3 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -1 Query: 177 HDGQGNNAGSLVSITKVFA 121 H G G N G + ITK+ A Sbjct: 148 HTGVGRNVGYKIPITKLTA 166 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 21.0 bits (42), Expect = 7.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -1 Query: 423 LDAFVFGANVLDLAG 379 L AF+FGAN L G Sbjct: 53 LSAFLFGANALFTPG 67 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 21.0 bits (42), Expect = 7.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 120 QQIPW*CLQGIQHCS 164 QQI W L+ IQ CS Sbjct: 557 QQIAWMALKMIQACS 571 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.309 0.134 0.384 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 106,884 Number of Sequences: 438 Number of extensions: 1793 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14354847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.2 bits)
- SilkBase 1999-2023 -