BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32202 (516 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomy... 29 0.41 SPBC1271.10c |||membrane transporter|Schizosaccharomyces pombe|c... 27 1.3 SPAC3F10.02c |trk1|sptrk|potassium ion transporter Trk1|Schizosa... 27 1.7 SPAC1F7.09c |||allantoicase |Schizosaccharomyces pombe|chr 1|||M... 27 2.2 SPCC1235.01 ||SPCC320.02c|sequence orphan|Schizosaccharomyces po... 26 2.9 SPAC3H5.04 |aar2||U5 snRNP-associated protein Aar2|Schizosacchar... 26 2.9 SPAC25B8.15c |||wybutosine biosynthesis protein Tyw3|Schizosacch... 26 2.9 SPBC106.19 ||SPBC582.01|sequence orphan|Schizosaccharomyces pomb... 26 3.8 SPAC17H9.01 |cid16||poly|Schizosaccharomyces pombe|chr 1|||Manual 25 6.7 SPBC18H10.05 |||WD repeat protein Wdr44 family, WD repeat protei... 25 6.7 SPAC1093.06c |dhc1|SPAC30C2.01c|dynein heavy chain |Schizosaccha... 25 6.7 SPAC1751.01c |gti1||gluconate transporter inducer Gti1|Schizosac... 25 8.9 SPCC1919.03c |||AMP-activated protein kinase beta subunit |Schiz... 25 8.9 SPAC12B10.08c |||mitochondrial tRNA|Schizosaccharomyces pombe|ch... 25 8.9 SPBC1289.15 ||SPBC8E4.07c|glycoprotein |Schizosaccharomyces pomb... 25 8.9 SPAC22H10.10 |alp21|sto1|tubulin specific chaperone cofactor E|S... 25 8.9 >SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomyces pombe|chr 1|||Manual Length = 4924 Score = 29.1 bits (62), Expect = 0.41 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -2 Query: 155 VFVYPYEPTPKESEPFKSVVPDNKPFGYP 69 + VY + P +SE F +VV DN YP Sbjct: 4194 ILVYQHLPDSSQSETFLNVVTDNSAVDYP 4222 >SPBC1271.10c |||membrane transporter|Schizosaccharomyces pombe|chr 2|||Manual Length = 581 Score = 27.5 bits (58), Expect = 1.3 Identities = 13/46 (28%), Positives = 23/46 (50%), Gaps = 4/46 (8%) Frame = -2 Query: 458 VKMFLGPKYDENGFPFSLEDNWMNFY----ELDWFVQKVNPGQSQI 333 +++FL P +G + +D W++FY E DW N G + + Sbjct: 338 LRIFLFPAVLYSGLQWGAQDAWLSFYLTTEEEDWMEAPYNYGDNAV 383 >SPAC3F10.02c |trk1|sptrk|potassium ion transporter Trk1|Schizosaccharomyces pombe|chr 1|||Manual Length = 841 Score = 27.1 bits (57), Expect = 1.7 Identities = 18/67 (26%), Positives = 28/67 (41%), Gaps = 2/67 (2%) Frame = -2 Query: 368 FVQKVNPGQSQITRSSTDFAFFKEDSLPMAEIYK--LLDQGKIPTDMFNSSDTMPSRLML 195 F+ VNP ++ TR + ++SLPMA Y L + + + P + Sbjct: 258 FISSVNPLEADDTRETLSEGALVQESLPMAYSYSDTNLVVSRDSFTLTGDDNLFPEGGLR 317 Query: 194 PKGTYDG 174 P T DG Sbjct: 318 PANTIDG 324 >SPAC1F7.09c |||allantoicase |Schizosaccharomyces pombe|chr 1|||Manual Length = 342 Score = 26.6 bits (56), Expect = 2.2 Identities = 9/34 (26%), Positives = 15/34 (44%) Frame = -2 Query: 374 DWFVQKVNPGQSQITRSSTDFAFFKEDSLPMAEI 273 DW + K+ P ++T D FF + P + Sbjct: 82 DWVIVKLGPSSGRVTGCEIDTTFFNGNHAPEVSV 115 >SPCC1235.01 ||SPCC320.02c|sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 658 Score = 26.2 bits (55), Expect = 2.9 Identities = 18/60 (30%), Positives = 29/60 (48%) Frame = +1 Query: 67 NG*PNGLLSGTTDLNGSDSLGVGSYG*TNTNSWKGNPSYVPLGSISLEGIVSEELNMSVG 246 +G + L + + N +++ G+Y N NS N + S SL+G+ S LN S G Sbjct: 550 SGMASSFLGSSGNNNNNNNSNSGNYN--NNNSGNNNQQHQQSSS-SLQGLASSFLNSSSG 606 >SPAC3H5.04 |aar2||U5 snRNP-associated protein Aar2|Schizosaccharomyces pombe|chr 1|||Manual Length = 346 Score = 26.2 bits (55), Expect = 2.9 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = -2 Query: 515 HKPFTVTIDIKSDVATNAVVKMFLGPKYDENGFPFSLEDNW 393 H+ +ID S T ++ K L YDEN +PF +W Sbjct: 58 HEDMKYSIDFDSKSETASLQK--LDVLYDENFYPFESTKDW 96 >SPAC25B8.15c |||wybutosine biosynthesis protein Tyw3|Schizosaccharomyces pombe|chr 1|||Manual Length = 237 Score = 26.2 bits (55), Expect = 2.9 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -2 Query: 116 EPFKSVVPDNKPFGYPFDRPVLP 48 E KS VPD P G+P D P+ P Sbjct: 19 EGLKSSVPDASPKGHP-DSPIFP 40 >SPBC106.19 ||SPBC582.01|sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 515 Score = 25.8 bits (54), Expect = 3.8 Identities = 19/68 (27%), Positives = 30/68 (44%), Gaps = 5/68 (7%) Frame = +1 Query: 253 PWSKSL*ISAIGKE-----SSLKNAKSVDERVI*DWPGLTFCTNQSSS*KFIQLSSRLKG 417 PWS++ S G +S+K+A + + I + L N + KF KG Sbjct: 5 PWSRNFLCSCRGFSVCTPYASIKSASELALKNISELQALQKIQNHTEKLKFFSSKLHNKG 64 Query: 418 KPFSSYLG 441 +PF+ LG Sbjct: 65 EPFTLQLG 72 >SPAC17H9.01 |cid16||poly|Schizosaccharomyces pombe|chr 1|||Manual Length = 1202 Score = 25.0 bits (52), Expect = 6.7 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -2 Query: 383 YELDWFVQKVNPGQSQITRSSTDF 312 Y DW ++ SQ+ R ST+F Sbjct: 1123 YSFDWEAYMIDISSSQLKRKSTEF 1146 >SPBC18H10.05 |||WD repeat protein Wdr44 family, WD repeat protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 586 Score = 25.0 bits (52), Expect = 6.7 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -3 Query: 265 SWTKERFLLTCSTPRTLCL 209 SW+K FLLT S RT+ L Sbjct: 262 SWSKNDFLLTSSADRTVRL 280 >SPAC1093.06c |dhc1|SPAC30C2.01c|dynein heavy chain |Schizosaccharomyces pombe|chr 1|||Manual Length = 4196 Score = 25.0 bits (52), Expect = 6.7 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = -2 Query: 197 LPKGTYDGFPFQLFVFVYPYEPTPKESEPFKSVVPDNK 84 L + T D ++ ++FV+ E +P+ E S++ DNK Sbjct: 2232 LLRKTRDSCYYKRYMFVFDDELSPEWVEAMNSLLDDNK 2269 >SPAC1751.01c |gti1||gluconate transporter inducer Gti1|Schizosaccharomyces pombe|chr 1|||Manual Length = 720 Score = 24.6 bits (51), Expect = 8.9 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -2 Query: 506 FTVTIDIKSDVATNAVVKMFLGPKYDENGFPFS 408 FTV++ + DVA++ + P +N FP S Sbjct: 115 FTVSVPVDVDVASHVNISSPSAPSLSDNLFPGS 147 >SPCC1919.03c |||AMP-activated protein kinase beta subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 298 Score = 24.6 bits (51), Expect = 8.9 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +2 Query: 131 SVHTDRRIQTAGRGIHRMY 187 S HT RR QT+G+ H+ Y Sbjct: 76 SGHTKRRSQTSGKKTHQPY 94 >SPAC12B10.08c |||mitochondrial tRNA|Schizosaccharomyces pombe|chr 1|||Manual Length = 456 Score = 24.6 bits (51), Expect = 8.9 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -3 Query: 277 KSTSSWTKERFLLTCSTPRTLCLQ 206 K S+ TKE LL C T T C Q Sbjct: 279 KKHSNLTKEELLLRCLTLTTSCRQ 302 >SPBC1289.15 ||SPBC8E4.07c|glycoprotein |Schizosaccharomyces pombe|chr 2|||Manual Length = 1283 Score = 24.6 bits (51), Expect = 8.9 Identities = 12/46 (26%), Positives = 22/46 (47%) Frame = -2 Query: 362 QKVNPGQSQITRSSTDFAFFKEDSLPMAEIYKLLDQGKIPTDMFNS 225 Q N Q +T +T ++ +SLP+ + + IPT +N+ Sbjct: 112 QNTNTTQVSLTNGTTTNSYSNTNSLPITDTINGTTELIIPTTSYNN 157 >SPAC22H10.10 |alp21|sto1|tubulin specific chaperone cofactor E|Schizosaccharomyces pombe|chr 1|||Manual Length = 511 Score = 24.6 bits (51), Expect = 8.9 Identities = 17/49 (34%), Positives = 25/49 (51%) Frame = -2 Query: 410 SLEDNWMNFYELDWFVQKVNPGQSQITRSSTDFAFFKEDSLPMAEIYKL 264 SL +N +N Y D + V G + + SST A E LP+ ++KL Sbjct: 247 SLANN-LNLYSADGYAVDVFQGINNLNLSSTSLADVAE--LPVHTLHKL 292 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,045,072 Number of Sequences: 5004 Number of extensions: 42673 Number of successful extensions: 136 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 130 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 136 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 208287218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -