BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32202 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g13530.1 68416.m01701 MAP3K epsilon protein kinase identical ... 31 0.61 At3g03480.1 68416.m00346 transferase family protein similar to h... 31 0.61 At1g10760.1 68414.m01231 starch excess protein (SEX1) identical ... 29 1.9 At5g06630.1 68418.m00749 proline-rich extensin-like family prote... 28 3.2 At3g28550.1 68416.m03565 proline-rich extensin-like family prote... 28 4.3 At3g07980.1 68416.m00975 protein kinase, putative similar to MAP... 28 4.3 At1g23720.1 68414.m02994 proline-rich extensin-like family prote... 28 4.3 At5g45190.1 68418.m05547 cyclin family protein similar to cyclin... 27 5.7 At4g13390.1 68417.m02092 proline-rich extensin-like family prote... 27 7.5 At5g54350.1 68418.m06768 expressed protein ; expression support... 27 9.9 At3g54590.1 68416.m06040 proline-rich extensin-like family prote... 27 9.9 At3g54580.1 68416.m06039 proline-rich extensin-like family prote... 27 9.9 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 27 9.9 At2g24980.1 68415.m02987 proline-rich extensin-like family prote... 27 9.9 >At3g13530.1 68416.m01701 MAP3K epsilon protein kinase identical to MAP3K epsilon protein kinase [Arabidopsis thaliana] gi|3549652|emb|CAA12272 Length = 1368 Score = 30.7 bits (66), Expect = 0.61 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +1 Query: 118 DSLGVGSYG*TNTNSWKGNPSYVPLGSISLEGIVSEELN 234 D +G G+YG N +V + +SLE IV E+LN Sbjct: 24 DEIGKGAYGRVYKGLDLENGDFVAIKQVSLENIVQEDLN 62 >At3g03480.1 68416.m00346 transferase family protein similar to hypersensitivity-related gene GB:CAA64636 [Nicotiana tabacum]; contains Pfam transferase family domain PF00248 Length = 454 Score = 30.7 bits (66), Expect = 0.61 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 4/68 (5%) Frame = -2 Query: 215 MPSRLMLPKGTYDGFPFQLF----VFVYPYEPTPKESEPFKSVVPDNKPFGYPFDRPVLP 48 M ++ LP+ T G F++ V P +PTP+E +P S + D + G F PV+ Sbjct: 1 MDHQVSLPQSTTTGLSFKVHRQQRELVTPAKPTPRELKPL-SDIDDQQ--GLRFQIPVI- 56 Query: 47 QYFKQPNM 24 +F +PN+ Sbjct: 57 -FFYRPNL 63 >At1g10760.1 68414.m01231 starch excess protein (SEX1) identical to SEX1 [Arabidopsis thaliana] GI:12044358; supporting cDNA gi|12044357|gb|AF312027.1|AF312027 Length = 1399 Score = 29.1 bits (62), Expect = 1.9 Identities = 18/49 (36%), Positives = 26/49 (53%) Frame = +1 Query: 97 TTDLNGSDSLGVGSYG*TNTNSWKGNPSYVPLGSISLEGIVSEELNMSV 243 T+DL G+ S +G Y SW G P+ V L E ++SE+ N +V Sbjct: 1089 TSDLVGAKSRNIG-YLKGKVPSWVGIPTSVALPFGVFEKVISEKANQAV 1136 >At5g06630.1 68418.m00749 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 440 Score = 28.3 bits (60), Expect = 3.2 Identities = 15/46 (32%), Positives = 21/46 (45%) Frame = -2 Query: 152 FVYPYEPTPKESEPFKSVVPDNKPFGYPFDRPVLPQYFKQPNMFFK 15 +VY P P S P V + P Y + P P Y PN+++K Sbjct: 308 YVYSSPPPPYYS-PSPKVYYKSPPPPYVYSSPPPPYYSPSPNVYYK 352 >At3g28550.1 68416.m03565 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1018 Score = 27.9 bits (59), Expect = 4.3 Identities = 15/46 (32%), Positives = 21/46 (45%) Frame = -2 Query: 152 FVYPYEPTPKESEPFKSVVPDNKPFGYPFDRPVLPQYFKQPNMFFK 15 +VY P P S P VV + P Y + P P Y P +++K Sbjct: 567 YVYSSPPPPYYS-PSPKVVYKSPPPPYVYSSPPPPYYSPSPKVYYK 611 >At3g07980.1 68416.m00975 protein kinase, putative similar to MAP3K epsilon protein kinase [Arabidopsis thaliana] gi|3549652|emb|CAA12272 Length = 1367 Score = 27.9 bits (59), Expect = 4.3 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +1 Query: 118 DSLGVGSYG*TNTNSWKGNPSYVPLGSISLEGIVSEELN 234 D +G G+YG N +V + +SLE I E+LN Sbjct: 24 DEIGKGAYGRVYIGLDLENGDFVAIKQVSLENIGQEDLN 62 >At1g23720.1 68414.m02994 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 895 Score = 27.9 bits (59), Expect = 4.3 Identities = 22/77 (28%), Positives = 27/77 (35%) Frame = -2 Query: 245 PTDMFNSSDTMPSRLMLPKGTYDGFPFQLFVFVYPYEPTPKESEPFKSVVPDNKPFGYPF 66 P SS P PK TY P +VY P P P V + P Y + Sbjct: 710 PPPYVYSSPPPPYYSPSPKPTYKSPPPP---YVYSSPPPPPYYSPSPKVEYKSPPPPYVY 766 Query: 65 DRPVLPQYFKQPNMFFK 15 P P Y P + +K Sbjct: 767 SSPPPPYYSPSPKVEYK 783 Score = 27.1 bits (57), Expect = 7.5 Identities = 24/77 (31%), Positives = 28/77 (36%) Frame = -2 Query: 245 PTDMFNSSDTMPSRLMLPKGTYDGFPFQLFVFVYPYEPTPKESEPFKSVVPDNKPFGYPF 66 P SS P PK TY P +VY P P S P VV + P Y + Sbjct: 433 PPPYVYSSPPPPYYSPSPKLTYKSSPPP---YVYSSPPPPYYS-PSPKVVYKSPPPPYVY 488 Query: 65 DRPVLPQYFKQPNMFFK 15 P P Y P +K Sbjct: 489 SSPPPPYYSPSPKPSYK 505 >At5g45190.1 68418.m05547 cyclin family protein similar to cyclin T1 [Equus caballus] GI:5052355; contains Pfam profile PF00134: Cyclin, N-terminal domain Length = 579 Score = 27.5 bits (58), Expect = 5.7 Identities = 22/60 (36%), Positives = 29/60 (48%) Frame = -2 Query: 515 HKPFTVTIDIKSDVATNAVVKMFLGPKYDENGFPFSLEDNWMNFYELDWFVQKVNPGQSQ 336 H+ F K+D T A V MFL K +E P L+D YE+ + K +PG SQ Sbjct: 89 HRFFFRQSHAKNDRRTIATVCMFLAGKVEET--PRPLKDVIFVSYEI---INKKDPGASQ 143 >At4g13390.1 68417.m02092 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 429 Score = 27.1 bits (57), Expect = 7.5 Identities = 21/78 (26%), Positives = 30/78 (38%), Gaps = 1/78 (1%) Frame = -2 Query: 245 PTDMFNSSDTMPSRLMLPKGTYDGFPFQLFVFVYPYEPTPKESEPFKSVVPDNKPFGYPF 66 P ++NS P P Y P +VY P P PF V + P Y + Sbjct: 342 PPYVYNSPPPPPYYSPSPTVNYKSPPPP---YVYNSPPPPPYYSPFPKVEYKSPPPPYIY 398 Query: 65 DRPVLPQYFK-QPNMFFK 15 + P P Y+ P + +K Sbjct: 399 NSPPPPPYYSPSPKITYK 416 >At5g54350.1 68418.m06768 expressed protein ; expression supported by MPSS Length = 279 Score = 26.6 bits (56), Expect = 9.9 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +1 Query: 91 SGTTDLNGSDSLGVGSYG*TNTNSWKG-NPSY 183 S T D+N +LG S+ TN +SW +PS+ Sbjct: 114 SSTNDINLDLTLGPSSWSNTNPSSWSNTDPSF 145 >At3g54590.1 68416.m06040 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 743 Score = 26.6 bits (56), Expect = 9.9 Identities = 23/83 (27%), Positives = 31/83 (37%) Frame = -2 Query: 263 LDQGKIPTDMFNSSDTMPSRLMLPKGTYDGFPFQLFVFVYPYEPTPKESEPFKSVVPDNK 84 +D P SS P+ PK Y P +VY P P S P V + Sbjct: 341 VDYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPP---YVYSSPPPPYYS-PSPKVEYKSP 396 Query: 83 PFGYPFDRPVLPQYFKQPNMFFK 15 P Y + P P Y P +++K Sbjct: 397 PPPYVYSSPPPPTYSPSPKVYYK 419 >At3g54580.1 68416.m06039 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 951 Score = 26.6 bits (56), Expect = 9.9 Identities = 22/77 (28%), Positives = 29/77 (37%) Frame = -2 Query: 245 PTDMFNSSDTMPSRLMLPKGTYDGFPFQLFVFVYPYEPTPKESEPFKSVVPDNKPFGYPF 66 P SS P+ PK Y P +VY P P S P V + P Y + Sbjct: 447 PPPYVYSSPPPPTYSPSPKVDYKSPPPP---YVYSSPPPPYYS-PSPKVYYKSPPPPYVY 502 Query: 65 DRPVLPQYFKQPNMFFK 15 P P Y P +++K Sbjct: 503 SSPPPPYYSPSPKVYYK 519 Score = 26.6 bits (56), Expect = 9.9 Identities = 13/45 (28%), Positives = 18/45 (40%) Frame = -2 Query: 149 VYPYEPTPKESEPFKSVVPDNKPFGYPFDRPVLPQYFKQPNMFFK 15 VY P P P V + P Y + P P Y P +++K Sbjct: 541 VYYKSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYK 585 Score = 26.6 bits (56), Expect = 9.9 Identities = 23/77 (29%), Positives = 28/77 (36%) Frame = -2 Query: 245 PTDMFNSSDTMPSRLMLPKGTYDGFPFQLFVFVYPYEPTPKESEPFKSVVPDNKPFGYPF 66 P SS P PK Y P V V P P P P VV + P Y + Sbjct: 663 PPPYVYSSPPPPYYSPSPKVYYKSPPHP-HVCVCP--PPPPCYSPSPKVVYKSPPPPYVY 719 Query: 65 DRPVLPQYFKQPNMFFK 15 P P Y P +++K Sbjct: 720 SSPPPPHYSPSPKVYYK 736 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 26.6 bits (56), Expect = 9.9 Identities = 15/41 (36%), Positives = 17/41 (41%) Frame = -2 Query: 152 FVYPYEPTPKESEPFKSVVPDNKPFGYPFDRPVLPQYFKQP 30 +VYP P P S P P P+ YP P P Y P Sbjct: 408 YVYPSPPPPPPSPPPYVYPPPPPPYVYP--PPPSPPYVYPP 446 >At2g24980.1 68415.m02987 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 559 Score = 26.6 bits (56), Expect = 9.9 Identities = 14/46 (30%), Positives = 20/46 (43%) Frame = -2 Query: 152 FVYPYEPTPKESEPFKSVVPDNKPFGYPFDRPVLPQYFKQPNMFFK 15 +VY P P S P V + P Y + P P Y P +++K Sbjct: 452 YVYSSPPPPYYS-PSPKVYYKSPPPSYVYSSPPPPYYSPSPKVYYK 496 Score = 26.6 bits (56), Expect = 9.9 Identities = 14/46 (30%), Positives = 20/46 (43%) Frame = -2 Query: 152 FVYPYEPTPKESEPFKSVVPDNKPFGYPFDRPVLPQYFKQPNMFFK 15 +VY P P S P V + P Y + P P Y P +++K Sbjct: 477 YVYSSPPPPYYS-PSPKVYYKSPPPSYVYSSPPPPYYSPSPKVYYK 521 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,668,768 Number of Sequences: 28952 Number of extensions: 222176 Number of successful extensions: 863 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 641 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 850 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -