BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32201 (516 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 22 2.8 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 21 4.9 AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 21 8.6 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 8.6 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 8.6 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 8.6 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 22.2 bits (45), Expect = 2.8 Identities = 10/33 (30%), Positives = 15/33 (45%) Frame = -2 Query: 272 VFLFKEMGSNITEAIEVDLPTVFRIVFIDECLK 174 +FL +GS + I +D F+D C K Sbjct: 674 IFLLLTLGSLLQMVISMDSTVEEAKTFVDRCYK 706 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 21.4 bits (43), Expect = 4.9 Identities = 16/67 (23%), Positives = 29/67 (43%) Frame = +3 Query: 48 EQKMAMLRKAFQMFDTTKSGYIDVLKISTILNTMGQLFDDSELQALIDENDPENSGKINF 227 EQK AF++ T + + ST + + ++ + + D N+ N + N Sbjct: 413 EQKSRRKGPAFKVDPTQVESEEEDEETSTTVFSNVEVVQEEAKKEESDSNNNNNKEEGNS 472 Query: 228 DGFCNIA 248 +CNIA Sbjct: 473 CQYCNIA 479 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 20.6 bits (41), Expect = 8.6 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +3 Query: 159 FDDSELQALIDENDP 203 FDD+ ++ D+NDP Sbjct: 42 FDDAFIRTSEDDNDP 56 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 20.6 bits (41), Expect = 8.6 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +3 Query: 159 FDDSELQALIDENDP 203 FDD+ ++ D+NDP Sbjct: 356 FDDAFIRTSEDDNDP 370 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 20.6 bits (41), Expect = 8.6 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +3 Query: 159 FDDSELQALIDENDP 203 FDD+ ++ D+NDP Sbjct: 589 FDDAFIRTSEDDNDP 603 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 20.6 bits (41), Expect = 8.6 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +3 Query: 159 FDDSELQALIDENDP 203 FDD+ ++ D+NDP Sbjct: 589 FDDAFIRTSEDDNDP 603 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 110,514 Number of Sequences: 336 Number of extensions: 1990 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12363686 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -