BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32191 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g10170.1 68414.m01147 NF-X1 type zinc finger family protein c... 30 1.1 At3g57780.1 68416.m06436 expressed protein 29 1.4 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 29 1.4 At4g17940.1 68417.m02672 expressed protein 28 3.2 At5g14610.1 68418.m01713 DEAD box RNA helicase, putative similar... 28 4.3 At2g26450.1 68415.m03173 pectinesterase family protein contains ... 28 4.3 At2g05564.1 68415.m00590 hypothetical protein 28 4.3 At1g24120.1 68414.m03043 DNAJ heat shock protein, putative simil... 28 4.3 At3g43390.1 68416.m04592 hypothetical protein similar to At3g243... 27 5.7 At1g70100.3 68414.m08067 expressed protein 27 5.7 At1g70100.2 68414.m08066 expressed protein 27 5.7 At1g70100.1 68414.m08065 expressed protein 27 5.7 At1g54890.1 68414.m06267 late embryogenesis abundant protein-rel... 27 5.7 At1g19490.1 68414.m02428 bZIP transcription factor family protei... 27 5.7 At1g14900.1 68414.m01781 high-mobility-group protein / HMG-I/Y p... 27 5.7 At4g39970.1 68417.m05661 haloacid dehalogenase-like hydrolase fa... 27 7.5 At3g59790.1 68416.m06672 mitogen-activated protein kinase, putat... 27 7.5 At2g21830.1 68415.m02594 DC1 domain-containing protein contains ... 27 7.5 >At1g10170.1 68414.m01147 NF-X1 type zinc finger family protein contains Pfam PF01422: NF-X1 type zinc finger; similar to transcriptional repressor NF-X1 (SP:Q12986) [Homo sapiens]; similar to EST gb|T21002 Length = 1188 Score = 29.9 bits (64), Expect = 1.1 Identities = 17/48 (35%), Positives = 20/48 (41%) Frame = -3 Query: 184 AGACPVCPERCFAPSVPNGSCNACLALPRTP*SCPDVRTPFRTMHKCS 41 AG C ++C AP A L P P CPD+R F CS Sbjct: 743 AGMRVTCRQKCGAPRTDCRHTCAALCHPSAP--CPDLRCEFSVTITCS 788 >At3g57780.1 68416.m06436 expressed protein Length = 670 Score = 29.5 bits (63), Expect = 1.4 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +1 Query: 118 RYTNHSVLMGRSTVQGRRDRRPRTASDTR 204 R TN+SV RST G+RD++P+ + + Sbjct: 4 RTTNNSVQSNRSTKNGKRDQKPQKTNGAK 32 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 29.5 bits (63), Expect = 1.4 Identities = 21/68 (30%), Positives = 28/68 (41%), Gaps = 3/68 (4%) Frame = -3 Query: 292 NCPAYDIIHCALISFIKFASPS--QWSTSEQCVYPRQY-AGACPVCPERCFAPSVPNGSC 122 N + + +H A +F PS Q S E Y Y +G P+C A V NG+ Sbjct: 288 NMKSLEELHVANNAFTGVIPPSICQLSNLENFTYSSNYFSGRPPICAASLLADIVVNGTM 347 Query: 121 NACLALPR 98 N L R Sbjct: 348 NCITGLAR 355 >At4g17940.1 68417.m02672 expressed protein Length = 274 Score = 28.3 bits (60), Expect = 3.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -3 Query: 418 DKKKVSDYFEQFAKDNPDWSAAVQNF 341 DK K+ DY+ + + NP+ S + N+ Sbjct: 146 DKSKIGDYYREMLRSNPNNSLLLMNY 171 >At5g14610.1 68418.m01713 DEAD box RNA helicase, putative similar to RNA helicase DRH1 [Arabidopsis thaliana] GI:3149952; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain, PF00397: WW domain Length = 713 Score = 27.9 bits (59), Expect = 4.3 Identities = 16/43 (37%), Positives = 24/43 (55%) Frame = +3 Query: 129 PFGTDGAKHRSGQTGQAPAYCLGYTHCSEVDHWDGDANLIKLI 257 P G + HR G+TG+A A L YT + D ++LIK++ Sbjct: 551 PNGVEDYVHRIGRTGRAGATGLAYTFFGDQDAKHA-SDLIKIL 592 >At2g26450.1 68415.m03173 pectinesterase family protein contains Pfam profiles: PF01095 pectinesterase,PF04043 plant invertase/pectin methylesterase inhibitor Length = 614 Score = 27.9 bits (59), Expect = 4.3 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = -3 Query: 451 KESGWAKNNVIDKKKVSDYFEQFAKDNPDWSAAVQNFKTTCL 326 KE A N I+ +V+ FE+ D W +AV +++ TCL Sbjct: 186 KEETVASLNKINVTEVNS-FEKVVPDLESWLSAVMSYQETCL 226 >At2g05564.1 68415.m00590 hypothetical protein Length = 231 Score = 27.9 bits (59), Expect = 4.3 Identities = 16/58 (27%), Positives = 26/58 (44%), Gaps = 1/58 (1%) Frame = -3 Query: 283 AYDIIHCALISFIKFASPSQWSTSEQCVYPRQYAGACPVCPERCFAPS-VPNGSCNAC 113 A DI L K+ + +++ + +YP + P C E C+ S + N CN C Sbjct: 161 ARDICEEVLEDIKKYGNTLKYTYANSFLYPECGDVSTPECAEMCYMRSRLFNNLCNQC 218 >At1g24120.1 68414.m03043 DNAJ heat shock protein, putative similar to Altered Response to Gravity [Arabidopsis thaliana] GI:4249662; contains Pfam profile PF00226 DnaJ domain Length = 436 Score = 27.9 bits (59), Expect = 4.3 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = -3 Query: 505 SEKCNKPISECDKTRCIFKESGWAKNNV-IDKKK 407 S + NK S CDK+ + K+S W ++ +DKKK Sbjct: 401 SRQKNKKPSTCDKSETLKKKSKWFNLHLKLDKKK 434 >At3g43390.1 68416.m04592 hypothetical protein similar to At3g24380, At5g36840, At5g35010, At3g42740, At4g05290, At2g14770, At2g05560, At4g08880, At1g34730, At1g27790, At1g34740, At1g27780, At5g36850, At3g42730, At1g52020, At3g24390, At4g05280, At1g25886, At4g03300 Length = 1113 Score = 27.5 bits (58), Expect = 5.7 Identities = 16/58 (27%), Positives = 26/58 (44%), Gaps = 1/58 (1%) Frame = -3 Query: 283 AYDIIHCALISFIKFASPSQWSTSEQCVYPRQYAGACPVCPERCFAPS-VPNGSCNAC 113 A DI L K+ + +++ + YP+ + P C E C+ S + N CN C Sbjct: 1043 ARDICEEVLEDIKKYGNTLKYTYANSFSYPKCGDVSTPECTEMCYMRSRLFNNLCNQC 1100 >At1g70100.3 68414.m08067 expressed protein Length = 504 Score = 27.5 bits (58), Expect = 5.7 Identities = 19/70 (27%), Positives = 26/70 (37%) Frame = -3 Query: 502 EKCNKPISECDKTRCIFKESGWAKNNVIDKKKVSDYFEQFAKDNPDWSAAVQNFKTTCLS 323 EK + PI + DK K+N + KK V+ K P ++ S Sbjct: 230 EKDHNPIKKTDKNVRTNHMRASPKSNQVTKKPVTSKVVSGRKTQPSKEKSMTKATNKAAS 289 Query: 322 DSLKPQGVDT 293 LKP G T Sbjct: 290 PVLKPPGFST 299 >At1g70100.2 68414.m08066 expressed protein Length = 482 Score = 27.5 bits (58), Expect = 5.7 Identities = 19/70 (27%), Positives = 26/70 (37%) Frame = -3 Query: 502 EKCNKPISECDKTRCIFKESGWAKNNVIDKKKVSDYFEQFAKDNPDWSAAVQNFKTTCLS 323 EK + PI + DK K+N + KK V+ K P ++ S Sbjct: 230 EKDHNPIKKTDKNVRTNHMRASPKSNQVTKKPVTSKVVSGRKTQPSKEKSMTKATNKAAS 289 Query: 322 DSLKPQGVDT 293 LKP G T Sbjct: 290 PVLKPPGFST 299 >At1g70100.1 68414.m08065 expressed protein Length = 467 Score = 27.5 bits (58), Expect = 5.7 Identities = 19/70 (27%), Positives = 26/70 (37%) Frame = -3 Query: 502 EKCNKPISECDKTRCIFKESGWAKNNVIDKKKVSDYFEQFAKDNPDWSAAVQNFKTTCLS 323 EK + PI + DK K+N + KK V+ K P ++ S Sbjct: 230 EKDHNPIKKTDKNVRTNHMRASPKSNQVTKKPVTSKVVSGRKTQPSKEKSMTKATNKAAS 289 Query: 322 DSLKPQGVDT 293 LKP G T Sbjct: 290 PVLKPPGFST 299 >At1g54890.1 68414.m06267 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein (EMB7) GI:1350543 from [Picea glauca] Length = 347 Score = 27.5 bits (58), Expect = 5.7 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -3 Query: 166 CPERCFAPSVPNGSCNACL 110 CP++C + S PNGS AC+ Sbjct: 49 CPKQCPSFSPPNGSTKACV 67 >At1g19490.1 68414.m02428 bZIP transcription factor family protein contains Pfam profile: PF00170 bZIP transcription factor Length = 471 Score = 27.5 bits (58), Expect = 5.7 Identities = 13/42 (30%), Positives = 24/42 (57%), Gaps = 3/42 (7%) Frame = -1 Query: 186 TRAPVPSALNGASPHQY---RMVRVTRASPCPAHRDHVQTSE 70 T+APV S +NG +P ++R +R++ C R ++ +E Sbjct: 115 TKAPVKSEINGETPKPILASTLIRCSRSNGCGRSRQNLSEAE 156 >At1g14900.1 68414.m01781 high-mobility-group protein / HMG-I/Y protein nearly identical to high-mobility-group protein HMG-I/Y protein [Arabidopsis thaliana] GI:1429211; contains Pfam profiles PF00538: linker histone H1 and H5 family, PF02178: AT hook motif Length = 204 Score = 27.5 bits (58), Expect = 5.7 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +1 Query: 136 VLMGRSTVQGRRDRRPRTASDTRTAPK 216 V+ G +GR +RPRT S+T AP+ Sbjct: 150 VITGSGRPRGRPPKRPRTDSETVAAPE 176 >At4g39970.1 68417.m05661 haloacid dehalogenase-like hydrolase family protein low similarity to SP|P95649 CbbY protein {Rhodobacter sphaeroides} Length = 316 Score = 27.1 bits (57), Expect = 7.5 Identities = 16/56 (28%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Frame = -3 Query: 469 KTRCIFKESGWAKNNVIDKKKVSDYFEQFAKDN-PDWSAAVQNFKTTCLSDSLKPQ 305 K R FKE+GW + + D +D D DW + +K S S++P+ Sbjct: 124 KMRWYFKENGWPTSTIFDSPPQNDDDRAKLIDTLQDWK--TERYKEIIKSGSVEPR 177 >At3g59790.1 68416.m06672 mitogen-activated protein kinase, putative / MAPK, putative (MPK10) mitogen-activated protein kinase (MAPK)(AtMPK10), PMID:12119167 Length = 393 Score = 27.1 bits (57), Expect = 7.5 Identities = 21/120 (17%), Positives = 50/120 (41%), Gaps = 3/120 (2%) Frame = -3 Query: 481 SECDKTRCIFKES-GWAKNNVIDKKKVSDYFE--QFAKDNPDWSAAVQNFKTTCLSDSLK 311 ++CD C F + ++N++ + V+ ++ + + D++AA+ + C+ + Sbjct: 196 TQCDLKICDFGLARATPESNLMTEYVVTRWYRAPELLLGSSDYTAAIDVWSVGCIFMEIM 255 Query: 310 PQGVDTNCPAYDIIHCALISFIKFASPSQWSTSEQCVYPRQYAGACPVCPERCFAPSVPN 131 + + P D ++ + +PS+ Y ++Y P P + F PN Sbjct: 256 NR--EPLFPGKDQVNQLRLLLELIGTPSEEELGSLSEYAKRYIRQLPTLPRQSFTEKFPN 313 >At2g21830.1 68415.m02594 DC1 domain-containing protein contains Pfam profilePF03107: DC1 domain Length = 569 Score = 27.1 bits (57), Expect = 7.5 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -3 Query: 208 QCVYPRQYAGACPVCPERCFAPSVPNGSCNAC 113 Q ++PR Y C +C ER +V SC C Sbjct: 521 QVMFPRSYQKVCIICHERVLGKAV---SCMEC 549 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,122,251 Number of Sequences: 28952 Number of extensions: 231655 Number of successful extensions: 648 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 636 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 648 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -