BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32180 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28981| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_2413| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_38583| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 >SB_28981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 655 Score = 29.1 bits (62), Expect = 2.3 Identities = 13/23 (56%), Positives = 18/23 (78%) Frame = +1 Query: 403 EKRQRLEEAEXKRQAMLQAMKDA 471 E+R+RLE E +RQA QAM++A Sbjct: 321 EERKRLENLEKERQAAQQAMQEA 343 >SB_2413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 493 Score = 28.3 bits (60), Expect = 4.0 Identities = 12/40 (30%), Positives = 25/40 (62%) Frame = +1 Query: 130 PAPKQEGEGDPEFIKRQDQKRSDLDEQLKEYINEWRKQRA 249 PA ++EGEG+P+ +R+ Q + ++Q K + +K ++ Sbjct: 56 PANEEEGEGEPKPKRRKAQPSAPKEKQTKSRKRDKKKDKS 95 >SB_38583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 27.1 bits (57), Expect = 9.2 Identities = 12/40 (30%), Positives = 24/40 (60%) Frame = +1 Query: 127 KPAPKQEGEGDPEFIKRQDQKRSDLDEQLKEYINEWRKQR 246 K + +G +F + Q ++ S L +QLK ++E++KQ+ Sbjct: 15 KKKKRNPDQGFADFAQAQQRQYSRLTKQLKPDMSEYKKQK 54 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,307,618 Number of Sequences: 59808 Number of extensions: 145125 Number of successful extensions: 431 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 410 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 431 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -