BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32164 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) 189 1e-48 SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) 186 7e-48 SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) 185 2e-47 SB_56| Best HMM Match : Actin (HMM E-Value=0) 185 2e-47 SB_56628| Best HMM Match : Actin (HMM E-Value=0) 185 2e-47 SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) 183 7e-47 SB_13344| Best HMM Match : Actin (HMM E-Value=1.5e-07) 166 1e-41 SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10) 68 4e-12 SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) 61 6e-10 SB_22343| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40) 34 0.080 SB_46036| Best HMM Match : PSRT (HMM E-Value=1) 29 3.0 SB_42882| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 29 3.0 SB_38754| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_10094| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_54| Best HMM Match : Actin (HMM E-Value=0) 27 6.9 SB_20153| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_34211| Best HMM Match : DUF1103 (HMM E-Value=6.4) 27 9.2 SB_17462| Best HMM Match : DUF1168 (HMM E-Value=0.37) 27 9.2 >SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 349 Score = 189 bits (460), Expect = 1e-48 Identities = 86/91 (94%), Positives = 90/91 (98%) Frame = -1 Query: 516 CDVDIRKDLYANTVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGS 337 CDVDIRKDLYANTVMSGGTTMYPG+ADRMQKEI+ALAPST+KIKIIAPPERKYSVWIGGS Sbjct: 259 CDVDIRKDLYANTVMSGGTTMYPGLADRMQKEISALAPSTMKIKIIAPPERKYSVWIGGS 318 Query: 336 ILASLSTFQQMWISKEEYDESGPGIVHRKCF 244 ILASLSTFQQMWISK+EYDESGP IVHRKCF Sbjct: 319 ILASLSTFQQMWISKQEYDESGPAIVHRKCF 349 >SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 186 bits (454), Expect = 7e-48 Identities = 85/91 (93%), Positives = 89/91 (97%) Frame = -1 Query: 516 CDVDIRKDLYANTVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGS 337 CDVDIRKDLYANTV+SGGTTMYPGIADRMQKEI+ALAP T+KIKIIAPPERKYSVWIGGS Sbjct: 248 CDVDIRKDLYANTVLSGGTTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGS 307 Query: 336 ILASLSTFQQMWISKEEYDESGPGIVHRKCF 244 ILASLSTFQQMWISK+EYDESGP IVHRKCF Sbjct: 308 ILASLSTFQQMWISKQEYDESGPAIVHRKCF 338 >SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 185 bits (451), Expect = 2e-47 Identities = 84/91 (92%), Positives = 89/91 (97%) Frame = -1 Query: 516 CDVDIRKDLYANTVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGS 337 CDVDIRKDLYANTV+SGG+TMYPGIADRMQKEIT+LAP T+KIKIIAPPERKYSVWIGGS Sbjct: 286 CDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGS 345 Query: 336 ILASLSTFQQMWISKEEYDESGPGIVHRKCF 244 ILASLSTFQQMWISK+EYDESGP IVHRKCF Sbjct: 346 ILASLSTFQQMWISKQEYDESGPSIVHRKCF 376 >SB_56| Best HMM Match : Actin (HMM E-Value=0) Length = 375 Score = 185 bits (451), Expect = 2e-47 Identities = 84/91 (92%), Positives = 89/91 (97%) Frame = -1 Query: 516 CDVDIRKDLYANTVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGS 337 CDVDIRKDLYANTV+SGG+TMYPGIADRMQKEIT+LAP T+KIKIIAPPERKYSVWIGGS Sbjct: 285 CDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGS 344 Query: 336 ILASLSTFQQMWISKEEYDESGPGIVHRKCF 244 ILASLSTFQQMWISK+EYDESGP IVHRKCF Sbjct: 345 ILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >SB_56628| Best HMM Match : Actin (HMM E-Value=0) Length = 376 Score = 185 bits (450), Expect = 2e-47 Identities = 84/91 (92%), Positives = 89/91 (97%) Frame = -1 Query: 516 CDVDIRKDLYANTVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGS 337 CDVDIRKDLYANTV+SGG+TMYPGIADRMQKEI+ALAP T+KIKIIAPPERKYSVWIGGS Sbjct: 286 CDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGS 345 Query: 336 ILASLSTFQQMWISKEEYDESGPGIVHRKCF 244 ILASLSTFQQMWISK+EYDESGP IVHRKCF Sbjct: 346 ILASLSTFQQMWISKQEYDESGPSIVHRKCF 376 >SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 183 bits (446), Expect = 7e-47 Identities = 83/91 (91%), Positives = 89/91 (97%) Frame = -1 Query: 516 CDVDIRKDLYANTVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGS 337 CDVDIRKDLYANTV+SGG+TM+PGIADRMQKEI+ALAP T+KIKIIAPPERKYSVWIGGS Sbjct: 285 CDVDIRKDLYANTVLSGGSTMFPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGS 344 Query: 336 ILASLSTFQQMWISKEEYDESGPGIVHRKCF 244 ILASLSTFQQMWISK+EYDESGP IVHRKCF Sbjct: 345 ILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >SB_13344| Best HMM Match : Actin (HMM E-Value=1.5e-07) Length = 149 Score = 166 bits (403), Expect = 1e-41 Identities = 74/91 (81%), Positives = 84/91 (92%) Frame = -1 Query: 516 CDVDIRKDLYANTVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGS 337 CDVDIRKDLY+N V+SGG+TM+PGIADRMQKEI LA +++K+K+IAPPERKYSVWIGGS Sbjct: 59 CDVDIRKDLYSNCVLSGGSTMFPGIADRMQKEIAMLANASMKVKVIAPPERKYSVWIGGS 118 Query: 336 ILASLSTFQQMWISKEEYDESGPGIVHRKCF 244 ILASLSTFQQMWI+KEEY E GP IVHRKCF Sbjct: 119 ILASLSTFQQMWIAKEEYHEYGPPIVHRKCF 149 >SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10) Length = 543 Score = 68.1 bits (159), Expect = 4e-12 Identities = 36/107 (33%), Positives = 57/107 (53%), Gaps = 16/107 (14%) Frame = -1 Query: 516 CDVDIRKDLYANTVMSGGTTMYPGIADRMQKEITA----------------LAPSTIKIK 385 C +D+R+ LY N V+SGG+TM+ R+Q++I + P I+ + Sbjct: 234 CPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDIKRTVDARLKMSETLSGGRIKPKPIETQ 293 Query: 384 IIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 244 +I+ ++Y+VW GGS+LAS F + +K +YDE GP I F Sbjct: 294 VISHHMQRYAVWFGGSMLASTPEFYSVCHTKADYDEHGPSICRHNPF 340 >SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) Length = 240 Score = 60.9 bits (141), Expect = 6e-10 Identities = 25/67 (37%), Positives = 47/67 (70%), Gaps = 3/67 (4%) Frame = -1 Query: 513 DVDIRKDLYANTVMSGGTTMYPGIADRMQKEITALAPSTIKIKII---APPERKYSVWIG 343 D+DIR L+ + +++GG T+ G +R+ +E+ + P ++++K+I + E++++ WIG Sbjct: 164 DIDIRAGLFNSVIVTGGNTLLQGFVERLNRELVSKTPPSMRLKLISNNSSVEKRFNPWIG 223 Query: 342 GSILASL 322 GSILASL Sbjct: 224 GSILASL 230 >SB_22343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 50.8 bits (116), Expect = 7e-07 Identities = 31/89 (34%), Positives = 43/89 (48%), Gaps = 9/89 (10%) Frame = -1 Query: 516 CDVDIRKDLYANTVMSGGTTMYPGIADRMQKEITALAPST-------IK-IKIIAPP-ER 364 C +D RK L N V+ GGT M PG R+ +EI L S IK +K+ PP Sbjct: 69 CPIDTRKTLAENIVLIGGTAMTPGFKHRLMQEIYLLLQSPKYKDKLFIKTVKMHQPPVNA 128 Query: 363 KYSVWIGGSILASLSTFQQMWISKEEYDE 277 + W+GG+I SL ++E Y + Sbjct: 129 NITAWLGGAIFGSLEVLADRSTTRERYQQ 157 >SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 411 Score = 48.8 bits (111), Expect = 3e-06 Identities = 36/110 (32%), Positives = 56/110 (50%), Gaps = 29/110 (26%) Frame = -1 Query: 513 DVDIRKDLYANTVMSGGTTMYPGIADRMQKEITAL---------------------APST 397 D+D R + Y + V+SGG+TMYPG+ R+++EI L P T Sbjct: 290 DIDTRSEFYKHIVLSGGSTMYPGLPSRLEREIKQLYLERVLKGDTSKLSSGMGMEQIPLT 349 Query: 396 I-----KIKI-IAPP-ERKYSVWIGGSILAS-LSTFQQMWISKEEYDESG 271 K KI I P RK+ V++GG++LA + W++++EY+E G Sbjct: 350 ADYLLQKFKIRIEDPPRRKHMVFMGGAVLADIMKDKDSFWMTRKEYEEKG 399 >SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40) Length = 367 Score = 33.9 bits (74), Expect = 0.080 Identities = 12/23 (52%), Positives = 20/23 (86%) Frame = -1 Query: 513 DVDIRKDLYANTVMSGGTTMYPG 445 D+D+R+ LY+N V+SGG+T++ G Sbjct: 269 DLDLRRVLYSNIVLSGGSTLFKG 291 >SB_46036| Best HMM Match : PSRT (HMM E-Value=1) Length = 878 Score = 28.7 bits (61), Expect = 3.0 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = -3 Query: 445 YRRQDAEGDHRPRALDHQDQDHRSPREE 362 +RRQDA DHR + DH QD PR++ Sbjct: 664 HRRQDA--DHRRQDADHHRQDVVHPRQD 689 >SB_42882| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 1973 Score = 28.7 bits (61), Expect = 3.0 Identities = 14/47 (29%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +2 Query: 335 MDPPIHTEYFLSGGAMILILMVEGARAVISFCILSAIPGYMV-VPPD 472 +DPP+ +Y L+GG ++ ++ FCI G++V PP+ Sbjct: 758 LDPPLENKYNLNGGQQVIQSTLQIQSLFFPFCIFQ---GFVVPTPPE 801 >SB_38754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 28.3 bits (60), Expect = 4.0 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -1 Query: 483 NTVMSGGTTMYPGIADRMQKEITALAP 403 N ++GG TMY R+++E+ A+ P Sbjct: 132 NVFVTGGNTMYNNFMARLERELLAIRP 158 >SB_10094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 27.9 bits (59), Expect = 5.3 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -1 Query: 486 ANTVMSGGTTMYPGIADRMQKEITALAP-STIKIKIIAPPE 367 AN V+ + + +R+ KE+ L +K KIIAPPE Sbjct: 44 ANPVIHPARKVPVSLGERLDKELNRLTELGIVKEKIIAPPE 84 >SB_54| Best HMM Match : Actin (HMM E-Value=0) Length = 2486 Score = 27.5 bits (58), Expect = 6.9 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = -1 Query: 516 CDVDIRKDLYANTVMSG 466 CD+D+R +L+ N V+SG Sbjct: 2330 CDIDLRAELFHNIVLSG 2346 >SB_20153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 27.5 bits (58), Expect = 6.9 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -1 Query: 486 ANTVMSGGTTMYPGIADRMQKEITALAP-STIKIKIIAPPE 367 AN V+ + + +R+ KE+ L +K KIIAPPE Sbjct: 44 ANPVIHPARKVPVSLGERLDKELNHLTELGIVKEKIIAPPE 84 >SB_34211| Best HMM Match : DUF1103 (HMM E-Value=6.4) Length = 126 Score = 27.1 bits (57), Expect = 9.2 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = -3 Query: 442 RRQDAEGDHRPRALDHQDQDHRSPREEVLRMDRWIHPGFP 323 RRQ HR R D +D+D R L DR+ + +P Sbjct: 4 RRQGTATIHRYRQSDLRDRDRRRVLPRFLEQDRFDNSDYP 43 >SB_17462| Best HMM Match : DUF1168 (HMM E-Value=0.37) Length = 352 Score = 27.1 bits (57), Expect = 9.2 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +1 Query: 148 SGITRYNVLTVAFRTRTSTTPHSTGVT 228 +GIT N++T A T TSTT + VT Sbjct: 294 NGITNTNIITTATTTTTSTTISTITVT 320 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,256,899 Number of Sequences: 59808 Number of extensions: 286917 Number of successful extensions: 943 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 853 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 937 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -