BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32160 (383 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 26 0.15 AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix... 22 2.4 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 20 9.7 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 20 9.7 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 25.8 bits (54), Expect = 0.15 Identities = 22/64 (34%), Positives = 27/64 (42%), Gaps = 1/64 (1%) Frame = -1 Query: 224 AVPIPPNEVAMPSRPFSILSSSIPWSAKLEISFTCPALSLPKLSSAE-SPKLPNPESWCP 48 A P PP E A P + + S P S E C L + +S E S L P CP Sbjct: 43 ASPAPPEEEAASPTPGDVPTPSSPRSIS-EDPLNCRDLPNSRCNSRESSDSLVQPR--CP 99 Query: 47 NPES 36 + ES Sbjct: 100 SGES 103 >AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix transcription factor protein. Length = 249 Score = 21.8 bits (44), Expect = 2.4 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +2 Query: 152 MV*TKIKSKRALKALPLHWAVSALPLVVPSPQ 247 +V T++ + LP A S LPL+VP PQ Sbjct: 174 LVPTRLANGDIALVLPTQGA-SPLPLLVPIPQ 204 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 19.8 bits (39), Expect = 9.7 Identities = 7/14 (50%), Positives = 7/14 (50%) Frame = +3 Query: 282 CQHNLFNSLELTCC 323 C H L LEL C Sbjct: 475 CNHGLVYDLELNIC 488 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 19.8 bits (39), Expect = 9.7 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = -2 Query: 190 LQGPFRFYLRLYHGLLNWKYPLRVRH 113 + GP + L YH L K P V H Sbjct: 275 MTGPQQRVLSGYHALSGLKAPPGVEH 300 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 77,575 Number of Sequences: 336 Number of extensions: 1544 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 8014124 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -