BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32160 (383 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55061| Best HMM Match : Defensin_beta (HMM E-Value=6.9) 36 0.011 SB_55701| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.046 SB_18297| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_32754| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.74 SB_19076| Best HMM Match : HECT (HMM E-Value=0) 29 1.7 SB_37295| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.3 SB_18722| Best HMM Match : RVT_1 (HMM E-Value=2.8e-08) 28 3.0 SB_56086| Best HMM Match : 7tm_1 (HMM E-Value=1.1e-06) 27 4.0 SB_23827| Best HMM Match : DUF809 (HMM E-Value=9.1) 27 5.2 SB_50779| Best HMM Match : DUF885 (HMM E-Value=1.4e-17) 27 6.9 SB_34419| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_15003| Best HMM Match : WAP (HMM E-Value=0.0036) 27 6.9 SB_56167| Best HMM Match : Plasmodium_HRP (HMM E-Value=6.8) 27 6.9 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_56228| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.2 SB_56071| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.2 SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.2 SB_30752| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.2 SB_1818| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.2 SB_52546| Best HMM Match : ResIII (HMM E-Value=0.21) 26 9.2 SB_43996| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.2 SB_26236| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.2 SB_25066| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.2 SB_21268| Best HMM Match : DnaJ_CXXCXGXG (HMM E-Value=3.7) 26 9.2 SB_9042| Best HMM Match : TNFR_c6 (HMM E-Value=7.8) 26 9.2 >SB_55061| Best HMM Match : Defensin_beta (HMM E-Value=6.9) Length = 350 Score = 35.9 bits (79), Expect = 0.011 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = -1 Query: 71 PNPESWCPNPESWCPNPESWCPN 3 PNP+S PNP+S PNP+S PN Sbjct: 31 PNPDSCYPNPDSCYPNPDSCYPN 53 Score = 35.9 bits (79), Expect = 0.011 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = -1 Query: 71 PNPESWCPNPESWCPNPESWCPN 3 PNP+S PNP+S PNP+S PN Sbjct: 199 PNPDSCYPNPDSCYPNPDSCYPN 221 Score = 35.5 bits (78), Expect = 0.015 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = -1 Query: 71 PNPESWCPNPESWCPNPESWCPN 3 PNP+S PNP+S PNP+S PN Sbjct: 66 PNPDSCNPNPDSCYPNPDSCYPN 88 Score = 33.5 bits (73), Expect = 0.060 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -1 Query: 71 PNPESWCPNPESWCPNPESWCPN 3 PNP+ PNP+S PNP+S PN Sbjct: 24 PNPDYCYPNPDSCYPNPDSCYPN 46 Score = 33.5 bits (73), Expect = 0.060 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -1 Query: 71 PNPESWCPNPESWCPNPESWCPN 3 PNP+S PNP+S PNP+ PN Sbjct: 157 PNPDSCYPNPDSCYPNPDYCYPN 179 Score = 33.1 bits (72), Expect = 0.080 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -1 Query: 71 PNPESWCPNPESWCPNPESWCPN 3 PNP+S PNP+S PNP+ PN Sbjct: 38 PNPDSCYPNPDSCYPNPDYCNPN 60 Score = 33.1 bits (72), Expect = 0.080 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -1 Query: 71 PNPESWCPNPESWCPNPESWCPN 3 PNP+ PNP+S PNP+S PN Sbjct: 150 PNPDYCNPNPDSCYPNPDSCYPN 172 Score = 33.1 bits (72), Expect = 0.080 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -1 Query: 71 PNPESWCPNPESWCPNPESWCPN 3 PNP+ PNP+S PNP+S PN Sbjct: 192 PNPDYCNPNPDSCYPNPDSCYPN 214 Score = 33.1 bits (72), Expect = 0.080 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -1 Query: 71 PNPESWCPNPESWCPNPESWCPN 3 PNP+S PNP+S PNP+ PN Sbjct: 206 PNPDSCYPNPDSCYPNPDYCNPN 228 Score = 33.1 bits (72), Expect = 0.080 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -1 Query: 71 PNPESWCPNPESWCPNPESWCPN 3 PNP+S PNP+S PNP+ PN Sbjct: 234 PNPDSCNPNPDSCYPNPDYCYPN 256 Score = 32.7 bits (71), Expect = 0.11 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -1 Query: 71 PNPESWCPNPESWCPNPESWCPN 3 PNP+ PNP+S PNP+S PN Sbjct: 59 PNPDYCNPNPDSCNPNPDSCYPN 81 Score = 32.7 bits (71), Expect = 0.11 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -1 Query: 71 PNPESWCPNPESWCPNPESWCPN 3 PNP+ PNP+S PNP+S PN Sbjct: 122 PNPDYCNPNPDSCNPNPDSCYPN 144 Score = 32.7 bits (71), Expect = 0.11 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -1 Query: 71 PNPESWCPNPESWCPNPESWCPN 3 PNP+S PNP+S PNP+ PN Sbjct: 129 PNPDSCNPNPDSCYPNPDYCNPN 151 Score = 32.7 bits (71), Expect = 0.11 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -1 Query: 71 PNPESWCPNPESWCPNPESWCPN 3 PNP+ PNP+S PNP+S PN Sbjct: 227 PNPDYCNPNPDSCNPNPDSCYPN 249 Score = 32.7 bits (71), Expect = 0.11 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -1 Query: 71 PNPESWCPNPESWCPNPESWCPN 3 PNP+S PNP+ PNP+S PN Sbjct: 262 PNPDSCNPNPDYCNPNPDSCYPN 284 Score = 31.1 bits (67), Expect = 0.32 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -1 Query: 71 PNPESWCPNPESWCPNPESWCPN 3 PNP+S PNP+ PNP+ PN Sbjct: 164 PNPDSCYPNPDYCYPNPDFCYPN 186 Score = 31.1 bits (67), Expect = 0.32 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -1 Query: 71 PNPESWCPNPESWCPNPESWCPN 3 PNP+S PNP+ PNP+ PN Sbjct: 241 PNPDSCYPNPDYCYPNPDYCYPN 263 Score = 30.7 bits (66), Expect = 0.43 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -1 Query: 71 PNPESWCPNPESWCPNPESWCPN 3 PNP+ PNP+S PNP+ PN Sbjct: 94 PNPDYCYPNPDSCYPNPDYCNPN 116 Score = 30.7 bits (66), Expect = 0.43 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -1 Query: 71 PNPESWCPNPESWCPNPESWCPN 3 PNP+ PNP+ PNP+S PN Sbjct: 248 PNPDYCYPNPDYCYPNPDSCNPN 270 Score = 30.3 bits (65), Expect = 0.56 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -1 Query: 71 PNPESWCPNPESWCPNPESWCPN 3 PNP+S PNP+ PNP+ PN Sbjct: 45 PNPDSCYPNPDYCNPNPDYCNPN 67 Score = 30.3 bits (65), Expect = 0.56 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -1 Query: 71 PNPESWCPNPESWCPNPESWCPN 3 PNP+S PNP+ PNP+ PN Sbjct: 101 PNPDSCYPNPDYCNPNPDYCNPN 123 Score = 30.3 bits (65), Expect = 0.56 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -1 Query: 71 PNPESWCPNPESWCPNPESWCPN 3 PNP+S PNP+ PNP+ PN Sbjct: 136 PNPDSCYPNPDYCNPNPDYCNPN 158 Score = 30.3 bits (65), Expect = 0.56 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -1 Query: 71 PNPESWCPNPESWCPNPESWCPN 3 PNP+ PNP+ PNP+S PN Sbjct: 143 PNPDYCNPNPDYCNPNPDSCYPN 165 Score = 30.3 bits (65), Expect = 0.56 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -1 Query: 71 PNPESWCPNPESWCPNPESWCPN 3 PNP+ PNP+ PNP+S PN Sbjct: 185 PNPDYCNPNPDYCNPNPDSCYPN 207 Score = 30.3 bits (65), Expect = 0.56 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -1 Query: 71 PNPESWCPNPESWCPNPESWCPN 3 PNP+S PNP+ PNP+ PN Sbjct: 213 PNPDSCYPNPDYCNPNPDYCNPN 235 Score = 30.3 bits (65), Expect = 0.56 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -1 Query: 71 PNPESWCPNPESWCPNPESWCPN 3 PNP+ PNP+S PNP+ PN Sbjct: 255 PNPDYCYPNPDSCNPNPDYCNPN 277 Score = 29.9 bits (64), Expect = 0.74 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -1 Query: 71 PNPESWCPNPESWCPNPESWCPN 3 PNP+ PNP+ PNP+S PN Sbjct: 52 PNPDYCNPNPDYCNPNPDSCNPN 74 Score = 29.9 bits (64), Expect = 0.74 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -1 Query: 71 PNPESWCPNPESWCPNPESWCPN 3 PNP+S PNP+S PN + PN Sbjct: 73 PNPDSCYPNPDSCYPNHDYCYPN 95 Score = 29.9 bits (64), Expect = 0.74 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -1 Query: 71 PNPESWCPNPESWCPNPESWCPN 3 PNP+ PNP+ PNP+S PN Sbjct: 115 PNPDYCNPNPDYCNPNPDSCNPN 137 Score = 29.9 bits (64), Expect = 0.74 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -1 Query: 71 PNPESWCPNPESWCPNPESWCPN 3 PNP+ PNP+ PNP+S PN Sbjct: 220 PNPDYCNPNPDYCNPNPDSCNPN 242 Score = 29.9 bits (64), Expect = 0.74 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -1 Query: 71 PNPESWCPNPESWCPNPESWCPN 3 PNP+ PNP+ PNP+S PN Sbjct: 304 PNPDYCNPNPDYCNPNPDSCNPN 326 Score = 29.1 bits (62), Expect = 1.3 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -1 Query: 71 PNPESWCPNPESWCPNPES 15 PNP+ PNP+S PNP+S Sbjct: 311 PNPDYCNPNPDSCNPNPDS 329 Score = 28.3 bits (60), Expect = 2.3 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -1 Query: 71 PNPESWCPNPESWCPNPESWCPN 3 PNP+ PNP+ PNP+ PN Sbjct: 171 PNPDYCYPNPDFCYPNPDYCNPN 193 Score = 27.9 bits (59), Expect = 3.0 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -1 Query: 71 PNPESWCPNPESWCPNPESWCPN 3 PNP+ PNP+ PNP+ PN Sbjct: 178 PNPDFCYPNPDYCNPNPDYCNPN 200 Score = 27.9 bits (59), Expect = 3.0 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -1 Query: 71 PNPESWCPNPESWCPNPESWCPN 3 PNP+ PNP+ PNP+ PN Sbjct: 290 PNPDYCNPNPDFCYPNPDYCNPN 312 Score = 27.9 bits (59), Expect = 3.0 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -1 Query: 71 PNPESWCPNPESWCPNPESWCPN 3 PNP+ PNP+ PNP+ PN Sbjct: 297 PNPDFCYPNPDYCNPNPDYCNPN 319 Score = 27.5 bits (58), Expect = 4.0 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -1 Query: 71 PNPESWCPNPESWCPNPESWCPN 3 PNP+S PN + PNP+ PN Sbjct: 80 PNPDSCYPNHDYCYPNPDYCYPN 102 Score = 27.5 bits (58), Expect = 4.0 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -1 Query: 71 PNPESWCPNPESWCPNPESWCPN 3 PN + PNP+ PNP+S PN Sbjct: 87 PNHDYCYPNPDYCYPNPDSCYPN 109 Score = 27.5 bits (58), Expect = 4.0 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -1 Query: 71 PNPESWCPNPESWCPNPESWCPN 3 PNP+ PNP+ PNP+ PN Sbjct: 108 PNPDYCNPNPDYCNPNPDYCNPN 130 Score = 26.6 bits (56), Expect = 6.9 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -1 Query: 71 PNPESWCPNPESWCPNPESWCPN 3 PNP+ PNP+S PN + PN Sbjct: 269 PNPDYCNPNPDSCYPNHDYCNPN 291 Score = 26.6 bits (56), Expect = 6.9 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -1 Query: 71 PNPESWCPNPESWCPNPESWCPN 3 PNP+S PN + PNP+ PN Sbjct: 276 PNPDSCYPNHDYCNPNPDYCNPN 298 Score = 26.2 bits (55), Expect = 9.2 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -1 Query: 71 PNPESWCPNPESWCPNPESW 12 PNP+S PNP+S SW Sbjct: 318 PNPDSCNPNPDSGSVGKASW 337 >SB_55701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 33.9 bits (74), Expect = 0.046 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = -1 Query: 83 SPKLPNPESWCPNPESWCPNPESWCPN 3 S ++P+P W P+P W +P W P+ Sbjct: 27 SVRIPDPRVWIPDPSMWILDPSVWIPD 53 >SB_18297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 32.7 bits (71), Expect = 0.11 Identities = 11/31 (35%), Positives = 25/31 (80%) Frame = -2 Query: 94 RARSHQSYRIRSRGVQIRSHGVQIRNHGVQI 2 R +SH++ R++S G +++SHG ++++HG ++ Sbjct: 55 RVKSHEN-RVKSHGNRVKSHGNRVKSHGNRV 84 Score = 32.7 bits (71), Expect = 0.11 Identities = 11/31 (35%), Positives = 25/31 (80%) Frame = -2 Query: 94 RARSHQSYRIRSRGVQIRSHGVQIRNHGVQI 2 R +SH++ R++S G +++SHG ++++HG ++ Sbjct: 118 RVKSHEN-RVKSHGNRVKSHGNRVKSHGNRV 147 Score = 31.1 bits (67), Expect = 0.32 Identities = 11/31 (35%), Positives = 24/31 (77%) Frame = -2 Query: 94 RARSHQSYRIRSRGVQIRSHGVQIRNHGVQI 2 R +SH + R++S G +++SHG ++++HG ++ Sbjct: 6 RVKSHGN-RVKSHGNRVKSHGNRVKSHGNRV 35 Score = 31.1 bits (67), Expect = 0.32 Identities = 11/31 (35%), Positives = 24/31 (77%) Frame = -2 Query: 94 RARSHQSYRIRSRGVQIRSHGVQIRNHGVQI 2 R +SH + R++S G +++SHG ++++HG ++ Sbjct: 13 RVKSHGN-RVKSHGNRVKSHGNRVKSHGNRV 42 Score = 31.1 bits (67), Expect = 0.32 Identities = 11/31 (35%), Positives = 24/31 (77%) Frame = -2 Query: 94 RARSHQSYRIRSRGVQIRSHGVQIRNHGVQI 2 R +SH + R++S G +++SHG ++++HG ++ Sbjct: 20 RVKSHGN-RVKSHGNRVKSHGNRVKSHGNRV 49 Score = 27.9 bits (59), Expect = 3.0 Identities = 10/31 (32%), Positives = 23/31 (74%) Frame = -2 Query: 94 RARSHQSYRIRSRGVQIRSHGVQIRNHGVQI 2 R +SH + R++S G +++SH ++++HG ++ Sbjct: 69 RVKSHGN-RVKSHGNRVKSHENRVKSHGNRV 98 Score = 27.5 bits (58), Expect = 4.0 Identities = 10/28 (35%), Positives = 20/28 (71%) Frame = -2 Query: 94 RARSHQSYRIRSRGVQIRSHGVQIRNHG 11 R +SH + R++S G ++ HG ++++HG Sbjct: 132 RVKSHGN-RVKSHGNRVTCHGNRVKSHG 158 Score = 26.2 bits (55), Expect = 9.2 Identities = 9/31 (29%), Positives = 23/31 (74%) Frame = -2 Query: 94 RARSHQSYRIRSRGVQIRSHGVQIRNHGVQI 2 R +SH++ R++S +++SH ++++HG ++ Sbjct: 104 RVKSHEN-RVKSHENRVKSHENRVKSHGNRV 133 >SB_32754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5659 Score = 29.9 bits (64), Expect = 0.74 Identities = 16/35 (45%), Positives = 24/35 (68%) Frame = -2 Query: 109 LCQNCRARSHQSYRIRSRGVQIRSHGVQIRNHGVQ 5 +C R SH S +++S GVQ++S GVQ ++ GVQ Sbjct: 80 VCSGKRHTSHYS-QLQSLGVQLQSLGVQPQSLGVQ 113 >SB_19076| Best HMM Match : HECT (HMM E-Value=0) Length = 2018 Score = 28.7 bits (61), Expect = 1.7 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = -1 Query: 200 VAMPSRPFSILSSSIPWSAKLEISFTCPALSLPKLSSAES 81 V PS+PFS+++S+I + E F+ L L SSA S Sbjct: 841 VCRPSQPFSLITSNIEATQASEELFSVEPLPLKSPSSATS 880 >SB_37295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 620 Score = 28.7 bits (61), Expect = 1.7 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -1 Query: 251 IFEVRAPPMAVPIPPNEVAMPSRPFS 174 I +V PP + P PPN A PS FS Sbjct: 268 IQDVTQPPPSTPAPPNTPAPPSGKFS 293 >SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2670 Score = 28.3 bits (60), Expect = 2.3 Identities = 22/60 (36%), Positives = 26/60 (43%), Gaps = 2/60 (3%) Frame = -1 Query: 209 PNEVAMPSRPFSILSSSIPWSAKLEISFTCPALSLPKLSSAESPKL--PNPESWCPNPES 36 P + PS S S+ P S S T P L S +E+P L PNP S C P S Sbjct: 921 PRKTRTPSSHQSPQSAP-PSSPCTPSSSTAPPLPTNPKSPSEAPSLNNPNPRSSCTTPPS 979 >SB_18722| Best HMM Match : RVT_1 (HMM E-Value=2.8e-08) Length = 421 Score = 27.9 bits (59), Expect = 3.0 Identities = 12/37 (32%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -1 Query: 119 PALSLPKLSSAESPKL-PNPESWCPNPESWCPNPESW 12 P+L +PK E + P E W P W + +SW Sbjct: 358 PSLGIPKERGREGGLVTPGAEIWMQTPSIWTRSGDSW 394 >SB_56086| Best HMM Match : 7tm_1 (HMM E-Value=1.1e-06) Length = 520 Score = 27.5 bits (58), Expect = 4.0 Identities = 9/19 (47%), Positives = 12/19 (63%), Gaps = 2/19 (10%) Frame = +3 Query: 195 CHFIGRYRHCHW--WCPHL 245 C+F G Y+H HW CP + Sbjct: 88 CYFFGYYKHPHWQSMCPEI 106 >SB_23827| Best HMM Match : DUF809 (HMM E-Value=9.1) Length = 159 Score = 27.1 bits (57), Expect = 5.2 Identities = 16/57 (28%), Positives = 26/57 (45%), Gaps = 1/57 (1%) Frame = -2 Query: 172 FYLRLYHGLLNWKYPL-RVRHCLCQNCRARSHQSYRIRSRGVQIRSHGVQIRNHGVQ 5 +Y+ YH + + L V +C+ A +H+ I+ GVQ G Q + G Q Sbjct: 69 YYVTPYH--VTYSVTLYHVTYCVTPYATAATHKKKEIKQDGVQAEQDGGQAKQDGGQ 123 >SB_50779| Best HMM Match : DUF885 (HMM E-Value=1.4e-17) Length = 815 Score = 26.6 bits (56), Expect = 6.9 Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = -3 Query: 168 IFVYTMVC*TGNILYVSGIV-FAKTVERGVTKAT 70 IF T+VC G I ++GIV FAK+ K+T Sbjct: 51 IFTITIVCGIGVIFLITGIVLFAKSTRTVPQKST 84 >SB_34419| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 824 Score = 26.6 bits (56), Expect = 6.9 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = -2 Query: 109 LCQNCRARSHQSYRIRSRGVQIRSHGVQIRNHGV 8 L QNC + SH+ + S +++R + NH V Sbjct: 592 LAQNCNSHSHEDVEVISNLIRMRLKTKPLANHYV 625 >SB_15003| Best HMM Match : WAP (HMM E-Value=0.0036) Length = 230 Score = 26.6 bits (56), Expect = 6.9 Identities = 14/56 (25%), Positives = 26/56 (46%) Frame = -1 Query: 176 SILSSSIPWSAKLEISFTCPALSLPKLSSAESPKLPNPESWCPNPESWCPNPESWC 9 ++ +S+P S L + L+ + + P P P+ P+P+ C N +S C Sbjct: 84 ALAMASLPRSVMLVLFLALWTLAQGQTTPVTCPTFPPPDECRPDPDDECKN-DSQC 138 >SB_56167| Best HMM Match : Plasmodium_HRP (HMM E-Value=6.8) Length = 285 Score = 26.6 bits (56), Expect = 6.9 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = -2 Query: 220 CRYRPMKWQCLQGPFRFYLRLYHGLLNWKYPLRVRHCLCQNCRAR 86 C R + WQC+Q Y+ + + +Y L+V L Q +R Sbjct: 60 CAARRLSWQCIQNTTYKYMAHLYSAEHPEYNLQVHGTLIQRRASR 104 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 26.6 bits (56), Expect = 6.9 Identities = 24/76 (31%), Positives = 27/76 (35%), Gaps = 2/76 (2%) Frame = -1 Query: 233 PPMAVPIPP--NEVAMPSRPFSILSSSIPWSAKLEISFTCPALSLPKLSSAESPKLPNPE 60 PP AVPIPP PS P P S + P P ++ P P P Sbjct: 1050 PPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPV--PPPRQPDPIPTNPAHPTEPPPR 1107 Query: 59 SWCPNPESWCPNPESW 12 P P P P SW Sbjct: 1108 QPKPTP---APRPRSW 1120 >SB_56228| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 969 Score = 26.2 bits (55), Expect = 9.2 Identities = 15/52 (28%), Positives = 21/52 (40%) Frame = -2 Query: 199 WQCLQGPFRFYLRLYHGLLNWKYPLRVRHCLCQNCRARSHQSYRIRSRGVQI 44 W +GP G + W + R CLC+NC YR + R V + Sbjct: 743 WGDKEGPHDMLKEWAQGNIRW-FESDYR-CLCENCDPSVSHRYRKQGRPVPV 792 >SB_56071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 856 Score = 26.2 bits (55), Expect = 9.2 Identities = 8/18 (44%), Positives = 14/18 (77%) Frame = +2 Query: 206 WAVSALPLVVPSPQISQM 259 W + AL L+VP+P+++ M Sbjct: 396 WTIQALRLLVPAPEVNNM 413 >SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1220 Score = 26.2 bits (55), Expect = 9.2 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -2 Query: 133 YPLRVRHCLCQNCRARSHQSYRIRSRGVQIRSH 35 +P R+ HC C + +YR+++ G RSH Sbjct: 736 HPKRIYHCNIDGCGKQFSTAYRLKAHG---RSH 765 >SB_30752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 584 Score = 26.2 bits (55), Expect = 9.2 Identities = 20/69 (28%), Positives = 30/69 (43%) Frame = -2 Query: 211 RPMKWQCLQGPFRFYLRLYHGLLNWKYPLRVRHCLCQNCRARSHQSYRIRSRGVQIRSHG 32 R ++CL G ++Y + HG + P R C+ C S +R R+R V G Sbjct: 491 RTTDYKCLHGRVKYYCKDCHG--SQICPHNRRKTRCRECNGGSICEHR-RARYVCKDCKG 547 Query: 31 VQIRNHGVQ 5 + HG Q Sbjct: 548 KGMCGHGKQ 556 >SB_1818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 26.2 bits (55), Expect = 9.2 Identities = 23/84 (27%), Positives = 39/84 (46%), Gaps = 2/84 (2%) Frame = -1 Query: 299 KQIVLTCLDQCLRPFAIFEVRAPPMAVPIPPNEVAMPSRPFSILSSSIPWSAKLEISFTC 120 +Q + T + A+F VR+ VPIPP V + ++ +SI +S + +S Sbjct: 20 RQAIKTAEGESTVTVALFWVRS---LVPIPPRRVWLIYAYVLLMLTSIRFSRDVSVSGDV 76 Query: 119 PALSLPKL--SSAESPKLPNPESW 54 + PK+ + ES K+ SW Sbjct: 77 LTVVKPKIIVVAYESLKIKENLSW 100 >SB_52546| Best HMM Match : ResIII (HMM E-Value=0.21) Length = 293 Score = 26.2 bits (55), Expect = 9.2 Identities = 15/52 (28%), Positives = 21/52 (40%) Frame = -2 Query: 199 WQCLQGPFRFYLRLYHGLLNWKYPLRVRHCLCQNCRARSHQSYRIRSRGVQI 44 W +GP G + W + R CLC+NC YR + R V + Sbjct: 203 WGDKEGPHDMLKEWAQGNIRW-FESDYR-CLCENCDPSVSHRYRKQGRPVPV 252 >SB_43996| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1056 Score = 26.2 bits (55), Expect = 9.2 Identities = 23/73 (31%), Positives = 35/73 (47%), Gaps = 3/73 (4%) Frame = -1 Query: 212 PPNEVAMPSRPFSILSSSIPWSAKLEISFTCPALSLPKLSSAE-SPK--LPNPESWCPNP 42 P E ++PS+ S+ S + E S P S P ++ SP+ P+PE P+P Sbjct: 751 PSPEHSLPSQEHSLPSPEHSQPSP-EHSQPSPEHSQPSPEHSQPSPEHSQPSPEHCQPSP 809 Query: 41 ESWCPNPESWCPN 3 E P+PE P+ Sbjct: 810 EHSQPSPEHSLPS 822 >SB_26236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 736 Score = 26.2 bits (55), Expect = 9.2 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = +2 Query: 161 TKIKSKRALKALPLHWAVSALPLVVP 238 TK++S+ ++++LP H A S L++P Sbjct: 573 TKVQSEASMRSLPTHIAESLTALMLP 598 >SB_25066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1167 Score = 26.2 bits (55), Expect = 9.2 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = -1 Query: 119 PALSLPKLSSAESPKLPNPESWCPNPESWCPNPESWCP 6 P+ SL +SS E K NP P+P P E+ CP Sbjct: 232 PSPSLSAVSSFERQKT-NPPHTAPSPPQADPAKEATCP 268 >SB_21268| Best HMM Match : DnaJ_CXXCXGXG (HMM E-Value=3.7) Length = 185 Score = 26.2 bits (55), Expect = 9.2 Identities = 20/69 (28%), Positives = 30/69 (43%) Frame = -2 Query: 211 RPMKWQCLQGPFRFYLRLYHGLLNWKYPLRVRHCLCQNCRARSHQSYRIRSRGVQIRSHG 32 R ++CL G ++Y + HG + P R C+ C S +R R+R V G Sbjct: 16 RTTDYKCLHGRVKYYCKDCHG--SQICPHNRRKTRCRECNGGSICEHR-RARYVCKDCKG 72 Query: 31 VQIRNHGVQ 5 + HG Q Sbjct: 73 KGMCEHGKQ 81 >SB_9042| Best HMM Match : TNFR_c6 (HMM E-Value=7.8) Length = 125 Score = 26.2 bits (55), Expect = 9.2 Identities = 20/69 (28%), Positives = 30/69 (43%) Frame = -2 Query: 211 RPMKWQCLQGPFRFYLRLYHGLLNWKYPLRVRHCLCQNCRARSHQSYRIRSRGVQIRSHG 32 R ++CL G ++Y + HG + P R C+ C S +R R+R V G Sbjct: 22 RTTDYKCLHGRVKYYCKDCHG--SQICPHNRRKTRCRECNGGSICEHR-RARYVCKDCKG 78 Query: 31 VQIRNHGVQ 5 + HG Q Sbjct: 79 KGMCGHGKQ 87 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,330,411 Number of Sequences: 59808 Number of extensions: 237189 Number of successful extensions: 1049 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 764 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1017 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 656970245 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -