BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32159 (516 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 29 0.070 AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. 24 2.6 AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein ... 23 4.6 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 23 4.6 CR954256-2|CAJ14143.1| 295|Anopheles gambiae cyclin protein. 23 8.1 AY062191-1|AAL58552.1| 151|Anopheles gambiae cytochrome P450 CY... 23 8.1 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 23 8.1 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 29.5 bits (63), Expect = 0.070 Identities = 22/61 (36%), Positives = 37/61 (60%), Gaps = 5/61 (8%) Frame = +1 Query: 130 SIDYTKVTIKEKELYTPPL--DEVACVLSNGLTT--NF-KFVEVSVADSPDLTEPPYYLK 294 S+D K T K +ELY PPL ++ + + +G+++ NF KF E+ V S + PP +++ Sbjct: 118 SMDQVK-TDKPRELYIPPLPTEDESLIFGSGISSGINFDKFEEIQVRVSGE--NPPDHVE 174 Query: 295 S 297 S Sbjct: 175 S 175 >AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. Length = 189 Score = 24.2 bits (50), Expect = 2.6 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = -2 Query: 470 FTPRYGHGPAPAPARKAGSRFKCSSSLARS 381 F P +G GP P R+ R SS + S Sbjct: 24 FLPHFGQGPRGQPQRQQVQRSDSDSSSSES 53 >AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein protein. Length = 699 Score = 23.4 bits (48), Expect = 4.6 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +2 Query: 365 NATRYTTWPSCWN 403 N T Y +WPS W+ Sbjct: 195 NRTLYMSWPSSWS 207 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 23.4 bits (48), Expect = 4.6 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = +2 Query: 356 RRSNATRYTTWPSCWNT*TATPPSSPALEPDRGR 457 RRS +TR T+WP + P S P P R R Sbjct: 278 RRSRSTRPTSWP------RSRPTSKPKRLPRRRR 305 >CR954256-2|CAJ14143.1| 295|Anopheles gambiae cyclin protein. Length = 295 Score = 22.6 bits (46), Expect = 8.1 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -2 Query: 368 RLTCGTKYGGPPISTSLASPVNPG 297 R TCGT + IS+ A P +PG Sbjct: 208 RKTCGTGWKYRSISSLHAPPSHPG 231 >AY062191-1|AAL58552.1| 151|Anopheles gambiae cytochrome P450 CYP4H16 protein. Length = 151 Score = 22.6 bits (46), Expect = 8.1 Identities = 12/43 (27%), Positives = 19/43 (44%) Frame = +1 Query: 100 TLVTSTARMTSIDYTKVTIKEKELYTPPLDEVACVLSNGLTTN 228 T+V + A + + Y + IKE PP+ V L + N Sbjct: 48 TIVLTNALLQELKYLDLVIKESLRLVPPVPFVGRKLLEDMEMN 90 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 22.6 bits (46), Expect = 8.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -2 Query: 467 TPRYGHGPAPAPARK 423 TPR G PA PA+K Sbjct: 1100 TPRIGPAPAVEPAKK 1114 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 555,107 Number of Sequences: 2352 Number of extensions: 11607 Number of successful extensions: 18 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -