BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32157 (326 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 54 3e-10 DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 34 5e-04 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 54.4 bits (125), Expect = 3e-10 Identities = 24/66 (36%), Positives = 42/66 (63%), Gaps = 2/66 (3%) Frame = -2 Query: 316 AFAGFSVGKRNCIGKTYALISXKIILXHLVRRYKVTADIXKIEFKM--DXIMTPSDNCYV 143 AF FS G R+C+G+ YA++ KI+L ++R ++V +D+ + EF++ D I+ +D + Sbjct: 477 AFVPFSAGPRSCVGRKYAMLKLKIVLSTILRNFRVRSDVKESEFRLQADIILKRADGFKI 536 Query: 142 DFELRK 125 E RK Sbjct: 537 RLEPRK 542 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 33.9 bits (74), Expect = 5e-04 Identities = 15/66 (22%), Positives = 35/66 (53%) Frame = -2 Query: 325 NPNAFAGFSVGKRNCIGKTYALISXKIILXHLVRRYKVTADIXKIEFKMDXIMTPSDNCY 146 +P A F G+R C GK + ++ ++IL ++R +++ + +++ + + I+ P Sbjct: 452 SPLLVAPFGAGRRICPGKRFVDLALQLILAKIIREFEIIVE-EELDLQFEFILAPKGPVS 510 Query: 145 VDFELR 128 + F R Sbjct: 511 LGFRDR 516 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 65,770 Number of Sequences: 438 Number of extensions: 1015 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 50 effective length of database: 124,443 effective search space used: 7217694 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -