BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32151 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51805| Best HMM Match : DUF755 (HMM E-Value=6.8) 27 9.2 SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) 27 9.2 >SB_51805| Best HMM Match : DUF755 (HMM E-Value=6.8) Length = 369 Score = 27.1 bits (57), Expect = 9.2 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 1/58 (1%) Frame = +1 Query: 106 HHFVNQPSSGAKSDNSITTCHIICSFIKKDTQ-GGYLEQGHKYTALKLQKHASMYICT 276 HH QPS ++N+ H S DT GY++Q + ++H SM+ CT Sbjct: 140 HHPTIQPSGDRVTENTSLAKHTSSS----DTPCSGYIKQVEDFIQGIQRRHLSMFECT 193 >SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) Length = 675 Score = 27.1 bits (57), Expect = 9.2 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = -2 Query: 233 VYLWPCSKYPPCVSFLINEHIIWHVVIELSLLAPELG*LTKWC 105 VY WP +K SFL+ ++ ++ ++ L E L +C Sbjct: 378 VYTWPLNKVGEVGSFLLESALVCFPILMVAFLVSEQDFLPVYC 420 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,635,530 Number of Sequences: 59808 Number of extensions: 323753 Number of successful extensions: 617 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 500 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 607 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -