BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32138 (516 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_04_0474 + 18162538-18163731,18163800-18163855,18163951-181640... 29 1.7 03_05_0213 - 22037268-22039496 28 5.1 09_02_0088 + 4136698-4136857,4137530-4137558,4137992-4138954,413... 27 8.9 05_01_0554 + 4856131-4856605,4858051-4858098,4860611-4860792,486... 27 8.9 02_01_0223 + 1453478-1453750,1455788-1456018,1456066-1456200,145... 27 8.9 >11_04_0474 + 18162538-18163731,18163800-18163855,18163951-18164011, 18164107-18165495,18166024-18166635,18166706-18166852, 18166941-18167209,18167322-18167412,18167500-18167757, 18168376-18168450,18168937-18168945 Length = 1386 Score = 29.5 bits (63), Expect = 1.7 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -3 Query: 259 NPSRILHSNVFQKHKVQPPNSIPE 188 +P RILHSN+ QK+ PP + + Sbjct: 915 DPRRILHSNIVQKNDTVPPVGVEQ 938 >03_05_0213 - 22037268-22039496 Length = 742 Score = 27.9 bits (59), Expect = 5.1 Identities = 20/85 (23%), Positives = 38/85 (44%) Frame = +1 Query: 217 YAFGKRLNEEFDSDLLLQAFTDRTYIIKEEMKQKEMGVDIPMKDNMELIAEGEKFINEYV 396 +A G + EE L D ++ EM+++ V + + + EG++ ++ V Sbjct: 70 FAPGPEVYEEIIRKLGAVGALDLMKVLVAEMRREGHQVKLGVVHSFLDSYEGQQLFDDAV 129 Query: 397 QLYLETVLPKFPLEGVNEVRNYLTN 471 L L + P F ++ V N+L N Sbjct: 130 DLILNQLQPLFGIQADTVVYNHLLN 154 >09_02_0088 + 4136698-4136857,4137530-4137558,4137992-4138954, 4138973-4139301,4139398-4139485,4139766-4139864, 4139935-4140245,4140532-4140685 Length = 710 Score = 27.1 bits (57), Expect = 8.9 Identities = 15/58 (25%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = +1 Query: 241 EEFDSDLLLQAFTDRTYIIKEEMKQKEMGVDIPMKDNMELIA-EGEKFINEYVQLYLE 411 E FD + +++ + ++ ++E ++ + MGVD+ M+ + A EG +E V++ +E Sbjct: 193 EAFDDEGAMKSQSVKSLTVEEVIESQGMGVDVNMQKKEAVDANEGRSQESERVEINVE 250 >05_01_0554 + 4856131-4856605,4858051-4858098,4860611-4860792, 4861409-4863136 Length = 810 Score = 27.1 bits (57), Expect = 8.9 Identities = 15/58 (25%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = +1 Query: 241 EEFDSDLLLQAFTDRTYIIKEEMKQKEMGVDIPMKDNMELIA-EGEKFINEYVQLYLE 411 E FD + +++ + ++ ++E ++ + MGVD+ M+ + A EG +E V++ +E Sbjct: 365 EAFDDEGAMKSQSVKSLTVEEVIESQGMGVDVNMQKKEAVDANEGRSQESERVEINVE 422 >02_01_0223 + 1453478-1453750,1455788-1456018,1456066-1456200, 1457918-1457971,1458417-1458482,1458593-1458679, 1459338-1459394,1459470-1459500,1459577-1459634, 1459710-1459761,1459881-1459917,1460008-1460210, 1460556-1460633,1460683-1460853,1461126-1461239 Length = 548 Score = 27.1 bits (57), Expect = 8.9 Identities = 21/82 (25%), Positives = 37/82 (45%) Frame = +1 Query: 232 RLNEEFDSDLLLQAFTDRTYIIKEEMKQKEMGVDIPMKDNMELIAEGEKFINEYVQLYLE 411 RL ++ D L++A Y+ + E ++ + D +N L AE E+ EY L Sbjct: 450 RLRKQNIMDSLIEA---PKYLFQAECEELSVRADNLRAENSSLRAELERIKKEYEALLSH 506 Query: 412 TVLPKFPLEGVNEVRNYLTNED 477 K LEG ++ Y+ ++ Sbjct: 507 NASLKEKLEGNSDSIPYMNEQN 528 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,205,882 Number of Sequences: 37544 Number of extensions: 182856 Number of successful extensions: 353 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 348 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 353 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1118831240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -