BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32126 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g14030.1 68418.m01640 translocon-associated protein beta (TRA... 49 2e-06 At3g11550.1 68416.m01409 integral membrane family protein simila... 31 0.61 At3g54770.1 68416.m06060 RNA recognition motif (RRM)-containing ... 29 1.9 At2g13620.1 68415.m01501 cation/hydrogen exchanger, putative (CH... 28 4.3 At4g37800.1 68417.m05349 xyloglucan:xyloglucosyl transferase, pu... 27 5.7 At1g74240.1 68414.m08598 mitochondrial substrate carrier family ... 27 5.7 At5g02010.1 68418.m00120 expressed protein contains Pfam profile... 27 7.5 At4g21410.1 68417.m03093 protein kinase family protein contains ... 27 7.5 At4g08250.1 68417.m01361 scarecrow transcription factor family p... 27 7.5 At2g43370.1 68415.m05392 U1 small nuclear ribonucleoprotein 70 k... 27 7.5 At2g27650.1 68415.m03351 ubiquitin carboxyl-terminal hydrolase-r... 27 7.5 At1g68560.1 68414.m07833 alpha-xylosidase (XYL1) identical to al... 27 9.9 >At5g14030.1 68418.m01640 translocon-associated protein beta (TRAPB) family protein low similarity to SP|P23438 Translocon-associated protein, beta subunit precursor (TRAP-beta) (Signal sequence receptor beta subunit) {Canis familiaris}; contains Pfam profile PF05753: Translocon-associated protein beta (TRAPB) Length = 195 Score = 48.8 bits (111), Expect = 2e-06 Identities = 37/134 (27%), Positives = 60/134 (44%), Gaps = 3/134 (2%) Frame = +1 Query: 61 AKLLYFVLFIAAAVSAD--DEPVLARLLVSKQVLNKYLVENMDILVKYTLFNVGSAPAVE 234 AKLL + + VSA V ++ K LN+ + V Y ++N GS+ A + Sbjct: 6 AKLLISAMAVFMLVSASFATSEVPFMVVHKKATLNRLKSGAERVSVSYDIYNQGSSSAYD 65 Query: 235 VKLVDNGFHPDVFTVVGGQLTAEIDRIAPQTNVSHVVTVRSNKYGYFNFSSAEVTYK-AS 411 V L DN + F VV G + +R+ +SH + + + G F + A VT++ + Sbjct: 66 VTLTDNSWDKKTFEVVNGNTSKSWERLDAGGILSHSIELEAKVKGVFYGAPAVVTFRIPT 125 Query: 412 EDATDVQYSISSAP 453 + A YS P Sbjct: 126 KPALQEAYSTPLLP 139 >At3g11550.1 68416.m01409 integral membrane family protein similar to unknown protein GB:AAD26967 [Arabidopsis thaliana]; contains TIGRFAM TIGR01569 : plant integral membrane protein TIGR01569; contains Pfam PF04535 : Domain of unknown function (DUF588) Length = 204 Score = 30.7 bits (66), Expect = 0.61 Identities = 17/63 (26%), Positives = 32/63 (50%) Frame = +1 Query: 67 LLYFVLFIAAAVSADDEPVLARLLVSKQVLNKYLVENMDILVKYTLFNVGSAPAVEVKLV 246 L +F F+ S DD P +++ ++ YLV ++ I V L + +AP + + ++ Sbjct: 72 LPFFTQFLQFEASYDDLPTFQFFVIAMALVGGYLVLSLPISVVTILRPLATAPRLLLLVL 131 Query: 247 DNG 255 D G Sbjct: 132 DTG 134 >At3g54770.1 68416.m06060 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 261 Score = 29.1 bits (62), Expect = 1.9 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +1 Query: 331 VSHVVTVRSNKYGYFNFSSAEVTYKASEDATDV 429 +S +T RS YG+ F A+ +A ED+T + Sbjct: 49 ISDKLTRRSKGYGFVTFKDAKAATRACEDSTPI 81 >At2g13620.1 68415.m01501 cation/hydrogen exchanger, putative (CHX15) monovalent cation:proton antiporter family 2 (CPA2) member, PMID:11500563 Length = 821 Score = 27.9 bits (59), Expect = 4.3 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +1 Query: 76 FVLFIAAAVSADDEPVLARLLVSKQVLN 159 ++LF+ A+S PVLAR+L +++N Sbjct: 165 YILFLGVALSVTAFPVLARILAELKLIN 192 >At4g37800.1 68417.m05349 xyloglucan:xyloglucosyl transferase, putative / xyloglucan endotransglycosylase, putative / endo-xyloglucan transferase, putative similar to N-terminal partial sequence of endo-xyloglucan transferase GI:2244732 from [Gossypium hirsutum] Length = 293 Score = 27.5 bits (58), Expect = 5.7 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -3 Query: 373 NSRTYWTGQSLHGIH*FEVQSYRFPR 296 NS+ +W G + H + E +SYR+ R Sbjct: 242 NSKNWWEGSAYHQLSPVEARSYRWVR 267 >At1g74240.1 68414.m08598 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 364 Score = 27.5 bits (58), Expect = 5.7 Identities = 16/57 (28%), Positives = 25/57 (43%) Frame = -1 Query: 444 ADRILDVCGVFAGFVCDFRRAEVEIAVLIGPDSHYMGYISLRCNPIDFRGQLSAYYS 274 A + D G F C+ + ++I G S + YIS P+ RG + YY+ Sbjct: 136 AGAVGDTLGSFIYVPCEVIKQRMQIQ---GTSSSWSSYISRNSVPVQPRGDMYGYYT 189 >At5g02010.1 68418.m00120 expressed protein contains Pfam profile PF03759: Domain of unknown function (DUF315) Length = 546 Score = 27.1 bits (57), Expect = 7.5 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = -2 Query: 470 TMAPSPGALLIEYWTSVASSLALYVTSAELKLK 372 T+ PSP I + +SV L YVT E +LK Sbjct: 479 TVPPSPSRFKIPHSSSVKRVLTAYVTKNEPRLK 511 >At4g21410.1 68417.m03093 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 679 Score = 27.1 bits (57), Expect = 7.5 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 2/48 (4%) Frame = +1 Query: 256 FHPDVFTVVGGQLTAEIDRIAPQTN--VSHVVTVRSNKYGYFNFSSAE 393 F PD V G TA A N VS + +++S YG++N SS + Sbjct: 30 FDPDFNCVDRGNFTAN-STFAGNLNRLVSSLSSLKSQAYGFYNLSSGD 76 >At4g08250.1 68417.m01361 scarecrow transcription factor family protein SCARECROW - Arabidopsis thaliana, PID:g1497987 Length = 483 Score = 27.1 bits (57), Expect = 7.5 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = -2 Query: 347 VTTWDTLV*GAILSISAVSCPPTTVNTSGWKPLSTSFTSTAGA 219 V W T + + + + P + T+G+KPL SFT+ A Sbjct: 398 VANWLTRITANDAEVESFASWPQWLETNGFKPLEVSFTNRCQA 440 >At2g43370.1 68415.m05392 U1 small nuclear ribonucleoprotein 70 kDa, putative Length = 333 Score = 27.1 bits (57), Expect = 7.5 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = +1 Query: 289 QLTAEIDRIAPQTNVSHVVTVRSNKYGYFNFSSAEVTYKASEDA 420 ++ ++ RI V H+VT S YG+ + + + +A EDA Sbjct: 82 EVMSKYGRIKNLRLVRHIVTGASRGYGFVEYETEKEMLRAYEDA 125 >At2g27650.1 68415.m03351 ubiquitin carboxyl-terminal hydrolase-related contains Pfam profiles PF04780: Protein of unknown function (DUF629), PF04781: Protein of unknown function (DUF627) Length = 1106 Score = 27.1 bits (57), Expect = 7.5 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = +1 Query: 109 DDEPVLARLLVSKQVLNKYLVENMDILVKYTLFNVGSAPAVEVK-LVDNGFHPDV 270 D A+LL+ L + EN++ L+K N+ + VE+K L+ F P+V Sbjct: 127 DASESFAQLLLEN--LKNDMKENLETLIKDAESNIADSKTVELKGLLQQDFEPEV 179 >At1g68560.1 68414.m07833 alpha-xylosidase (XYL1) identical to alpha-xylosidase precursor GB:AAD05539 GI:4163997 from [Arabidopsis thaliana]; contains Pfam profile PF01055: Glycosyl hydrolases family 31; identical to cDNA alpha-xylosidase precursor (XYL1) partial cds GI:4163996 Length = 915 Score = 26.6 bits (56), Expect = 9.9 Identities = 12/45 (26%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = -1 Query: 402 VCDFRRAEVEIAVLIGPDSHYMGYISLRCNPIDF-RGQLSAYYSK 271 V ++++A++ + V+ D H G+ NP+ + R +L A+ K Sbjct: 312 VDNYKKAKIPLDVIWNDDDHMDGHKDFTLNPVAYPRAKLLAFLDK 356 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,601,299 Number of Sequences: 28952 Number of extensions: 196372 Number of successful extensions: 573 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 559 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 573 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -