BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32120 (516 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_06_0027 - 9786808-9786858,9786959-9787045,9787141-9787259,978... 27 6.8 >10_06_0027 - 9786808-9786858,9786959-9787045,9787141-9787259, 9787382-9787620,9787863-9787949,9788163-9788707, 9788806-9789081 Length = 467 Score = 27.5 bits (58), Expect = 6.8 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = -2 Query: 128 LISFYIYSAMGGLWLGYLIRLCTKLL*PQIIIRCIE 21 L++FY++ GLWLG + KLL I+ CI+ Sbjct: 412 LLAFYLHLNGMGLWLGIVCGSIIKLLVLIIVSCCID 447 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,224,851 Number of Sequences: 37544 Number of extensions: 151364 Number of successful extensions: 247 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 240 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 247 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1118831240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -