BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32117 (516 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF414442-1|AAL65133.2|22152|Homo sapiens ovarian cancer related ... 33 0.59 AY210419-1|AAO34702.1| 3501|Homo sapiens CUB and sushi multiple ... 31 2.4 AB114605-1|BAC82444.1| 3667|Homo sapiens CSMD3 protein isoform 2... 31 2.4 AB114604-1|BAC82443.1| 3707|Homo sapiens CSMD3 protein isoform 1... 31 2.4 AB067481-1|BAB67787.2| 2977|Homo sapiens KIAA1894 protein protein. 31 2.4 >AF414442-1|AAL65133.2|22152|Homo sapiens ovarian cancer related tumor marker CA125 protein. Length = 22152 Score = 33.1 bits (72), Expect = 0.59 Identities = 16/48 (33%), Positives = 27/48 (56%) Frame = -3 Query: 466 YFSSLPPRAGSG*FARLLPSLDVVAVSQAPSPESNPDSPLPVTTMVVA 323 + ++ P S F+ + PS+ + + SPES P SPLPVT ++ + Sbjct: 5621 WMTTPPVEETSSGFSLMSPSMTSPSPVSSTSPESIPSSPLPVTALLTS 5668 >AY210419-1|AAO34702.1| 3501|Homo sapiens CUB and sushi multiple domains 3 protein. Length = 3501 Score = 31.1 bits (67), Expect = 2.4 Identities = 17/48 (35%), Positives = 21/48 (43%), Gaps = 2/48 (4%) Frame = -2 Query: 470 SLFFVTTSPCREWVICAPAAFLGCGSRFSGSLSG--IEP*FPVTRDNH 333 SL T R W P+ CG RF G SG + P +P DN+ Sbjct: 1250 SLLKCMTGERRAWDYPLPSCIAECGGRFKGESSGRILSPGYPFPYDNN 1297 >AB114605-1|BAC82444.1| 3667|Homo sapiens CSMD3 protein isoform 2 protein. Length = 3667 Score = 31.1 bits (67), Expect = 2.4 Identities = 17/48 (35%), Positives = 21/48 (43%), Gaps = 2/48 (4%) Frame = -2 Query: 470 SLFFVTTSPCREWVICAPAAFLGCGSRFSGSLSG--IEP*FPVTRDNH 333 SL T R W P+ CG RF G SG + P +P DN+ Sbjct: 1351 SLLKCMTGERRAWDYPLPSCIAECGGRFKGESSGRILSPGYPFPYDNN 1398 >AB114604-1|BAC82443.1| 3707|Homo sapiens CSMD3 protein isoform 1 protein. Length = 3707 Score = 31.1 bits (67), Expect = 2.4 Identities = 17/48 (35%), Positives = 21/48 (43%), Gaps = 2/48 (4%) Frame = -2 Query: 470 SLFFVTTSPCREWVICAPAAFLGCGSRFSGSLSG--IEP*FPVTRDNH 333 SL T R W P+ CG RF G SG + P +P DN+ Sbjct: 1391 SLLKCMTGERRAWDYPLPSCIAECGGRFKGESSGRILSPGYPFPYDNN 1438 >AB067481-1|BAB67787.2| 2977|Homo sapiens KIAA1894 protein protein. Length = 2977 Score = 31.1 bits (67), Expect = 2.4 Identities = 17/48 (35%), Positives = 21/48 (43%), Gaps = 2/48 (4%) Frame = -2 Query: 470 SLFFVTTSPCREWVICAPAAFLGCGSRFSGSLSG--IEP*FPVTRDNH 333 SL T R W P+ CG RF G SG + P +P DN+ Sbjct: 731 SLLKCMTGERRAWDYPLPSCIAECGGRFKGESSGRILSPGYPFPYDNN 778 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 78,300,429 Number of Sequences: 237096 Number of extensions: 1719687 Number of successful extensions: 4639 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4506 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4639 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4876707572 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -