BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32115 (368 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value S42187-1|AAB22845.1| 1475|Caenorhabditis elegans pTra2A protein. 30 0.45 M91371-1|AAA28150.1| 1475|Caenorhabditis elegans membrane protei... 30 0.45 AC006608-1|AAF39755.1| 1475|Caenorhabditis elegans Transformer :... 30 0.45 AF016669-5|AAY55870.1| 124|Caenorhabditis elegans Hypothetical ... 28 1.8 >S42187-1|AAB22845.1| 1475|Caenorhabditis elegans pTra2A protein. Length = 1475 Score = 30.3 bits (65), Expect = 0.45 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +3 Query: 51 TSEEDLKAFEKLTEMCAPENDKPVSDSDKGCERAKLLLD 167 T E+++ A E+ E+ E D D D+GCE + +LD Sbjct: 1225 TLEQNMNALEECFELGVDEYDFDEHDGDEGCELVQDMLD 1263 >M91371-1|AAA28150.1| 1475|Caenorhabditis elegans membrane protein protein. Length = 1475 Score = 30.3 bits (65), Expect = 0.45 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +3 Query: 51 TSEEDLKAFEKLTEMCAPENDKPVSDSDKGCERAKLLLD 167 T E+++ A E+ E+ E D D D+GCE + +LD Sbjct: 1225 TLEQNMNALEECFELGVDEYDFDEHDGDEGCELVQDMLD 1263 >AC006608-1|AAF39755.1| 1475|Caenorhabditis elegans Transformer : xx animals transformedinto males protein 2, isoform a protein. Length = 1475 Score = 30.3 bits (65), Expect = 0.45 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +3 Query: 51 TSEEDLKAFEKLTEMCAPENDKPVSDSDKGCERAKLLLD 167 T E+++ A E+ E+ E D D D+GCE + +LD Sbjct: 1225 TLEQNMNALEECFELGVDEYDFDEHDGDEGCELVQDMLD 1263 >AF016669-5|AAY55870.1| 124|Caenorhabditis elegans Hypothetical protein K10G6.5 protein. Length = 124 Score = 28.3 bits (60), Expect = 1.8 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = -1 Query: 134 VTVTDWFVIFWSAHLR*FLEGFQVLLAGKIFLALLNSSGYIE 9 + T W+ + W+ L F+ FQ++ A + FLALL SG I+ Sbjct: 55 IETTSWYPVVWTCWLHMFILYFQIMGACE-FLALL--SGLID 93 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,695,822 Number of Sequences: 27780 Number of extensions: 106718 Number of successful extensions: 298 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 295 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 298 length of database: 12,740,198 effective HSP length: 73 effective length of database: 10,712,258 effective search space used: 524900642 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -