BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32115 (368 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435330-1|ABD92645.1| 132|Apis mellifera OBP13 protein. 24 0.50 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 22 2.0 DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 22 2.6 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 4.6 >DQ435330-1|ABD92645.1| 132|Apis mellifera OBP13 protein. Length = 132 Score = 24.2 bits (50), Expect = 0.50 Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 8/53 (15%) Frame = +3 Query: 54 SEEDLKAFEKLTEMCAPEN--DKPVSDS------DKGCERAKLLLDCFVANKG 188 SEE + K+ +CA EN D +D DK E+ +DC + G Sbjct: 19 SEESINKLRKIESVCAEENGIDLKKADDVKKGIFDKNDEKLACYVDCMLKKVG 71 Score = 23.4 bits (48), Expect = 0.87 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = +3 Query: 108 NDKPVSDSDKGCERAKLLLDCFVAN 182 N K +++S+ C+++ LL CF+ N Sbjct: 102 NCKDITESNS-CKKSSKLLQCFIDN 125 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 22.2 bits (45), Expect = 2.0 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -1 Query: 200 DRETSFVCNETVEEKFCSFAAL 135 D+ T F VEE C F+A+ Sbjct: 452 DKSTEFFLATVVEEAACRFSAV 473 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 21.8 bits (44), Expect = 2.6 Identities = 11/40 (27%), Positives = 18/40 (45%) Frame = +1 Query: 157 FSSTVSLQTKEVSRSSHFKEQSL*CFNNYLIISKQSFFYC 276 F T+ +T+ + R S +S C N+ + S F C Sbjct: 339 FKQTICCKTRIIGRRSWVTRESQICNNSSSDKERNSSFKC 378 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.0 bits (42), Expect = 4.6 Identities = 6/11 (54%), Positives = 7/11 (63%) Frame = -1 Query: 119 WFVIFWSAHLR 87 WFV FW H + Sbjct: 425 WFVEFWEHHFQ 435 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 79,231 Number of Sequences: 438 Number of extensions: 1262 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 8804355 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -