BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32102 (307 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 22 6.0 AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleo... 22 6.0 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 21.8 bits (44), Expect = 6.0 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = -3 Query: 95 RLXIKSSAAXPCVSSWVRXSS 33 RL S+ PC S W R SS Sbjct: 55 RLAQASTCPVPCSSIWSRPSS 75 >AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleotidase protein. Length = 570 Score = 21.8 bits (44), Expect = 6.0 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +1 Query: 10 YYVDK*LSDDXRTQDETQGIAADDFMXSLXYN 105 Y+ K L + +T++ A D+F +L YN Sbjct: 72 YHTIKQLKSEYKTKNPLYLNAGDNFQGTLWYN 103 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 209,689 Number of Sequences: 2352 Number of extensions: 2139 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 563,979 effective HSP length: 55 effective length of database: 434,619 effective search space used: 19992474 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -