BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32102 (307 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. 20 7.9 EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 prot... 20 7.9 AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 prot... 20 7.9 >X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. Length = 162 Score = 19.8 bits (39), Expect = 7.9 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = -3 Query: 218 CLRNRNCRTISYVMFCLYFNXH*STLYESPXP 123 CL+N SY + +YFN + Y+ P Sbjct: 98 CLKNSADTISSYFVGKMYFNLIDTKCYKLEHP 129 >EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 19.8 bits (39), Expect = 7.9 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = -3 Query: 218 CLRNRNCRTISYVMFCLYFNXH*STLYESPXP 123 CL+N SY + +YFN + Y+ P Sbjct: 103 CLKNSADTISSYFVGKMYFNLIDTKCYKLEHP 134 >AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 19.8 bits (39), Expect = 7.9 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = -3 Query: 218 CLRNRNCRTISYVMFCLYFNXH*STLYESPXP 123 CL+N SY + +YFN + Y+ P Sbjct: 103 CLKNSADTISSYFVGKMYFNLIDTKCYKLEHP 134 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 61,413 Number of Sequences: 438 Number of extensions: 1096 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 49 effective length of database: 124,881 effective search space used: 6493812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -