BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32097 (516 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory recept... 23 2.1 AJ969955-1|CAI94742.1| 160|Tribolium castaneum torso-like prote... 21 4.9 AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 21 6.5 AM292356-1|CAL23168.2| 251|Tribolium castaneum gustatory recept... 21 6.5 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 8.6 >AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory receptor candidate 42 protein. Length = 347 Score = 22.6 bits (46), Expect = 2.1 Identities = 13/65 (20%), Positives = 31/65 (47%) Frame = -1 Query: 450 AVIVFRVHAVLCDFSDFTVVKLLT*CKKRVCELSAKHETVFVLVIQLQTFQEIFXRSLVF 271 +++ + ++ FS +TV+ + +++ C+L +K LV TF +L + Sbjct: 63 SIVAMVMGTIVNAFSCYTVLAPVLCKRQQYCQLMSKLLGNHQLVYNCHTFGRFLAPNLTY 122 Query: 270 VFLCL 256 + + L Sbjct: 123 LLVAL 127 Score = 22.2 bits (45), Expect = 2.8 Identities = 9/40 (22%), Positives = 21/40 (52%) Frame = -1 Query: 432 VHAVLCDFSDFTVVKLLT*CKKRVCELSAKHETVFVLVIQ 313 ++ VL ++ DF+ + K + ++ T F+++IQ Sbjct: 303 INVVLNNYPDFSAAGFFSINKTTLLQIIGNVTTFFIIIIQ 342 >AJ969955-1|CAI94742.1| 160|Tribolium castaneum torso-like protein protein. Length = 160 Score = 21.4 bits (43), Expect = 4.9 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = +3 Query: 132 PWRSPESAQLKPHTGNH 182 PW + Q+K +GNH Sbjct: 141 PWFAEHMGQIKVASGNH 157 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 21.0 bits (42), Expect = 6.5 Identities = 15/60 (25%), Positives = 30/60 (50%) Frame = -1 Query: 441 VFRVHAVLCDFSDFTVVKLLT*CKKRVCELSAKHETVFVLVIQLQTFQEIFXRSLVFVFL 262 +F A+ CDF VV ++ +KR ++ K + ++V F ++ +++FV L Sbjct: 74 IFFFFAICCDFIALIVVNIVHVFRKR--RVNYKDSNIGLVV--ANAFFLLWTPAVIFVVL 129 >AM292356-1|CAL23168.2| 251|Tribolium castaneum gustatory receptor candidate 35 protein. Length = 251 Score = 21.0 bits (42), Expect = 6.5 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = -1 Query: 399 TVVKLLT*CKKRVCELSAKHETVFVLVIQLQTFQEIF 289 T K L K+ V L +F+L + TF +IF Sbjct: 80 TKAKNLLYSKQIVTILKKTKSNIFILKESVDTFNDIF 116 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 20.6 bits (41), Expect = 8.6 Identities = 6/19 (31%), Positives = 12/19 (63%) Frame = +1 Query: 406 AEVTKDCMDPEDDDXMIPY 462 +E+ + DP +DD ++ Y Sbjct: 162 SEIVETVYDPREDDRVVCY 180 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 96,247 Number of Sequences: 336 Number of extensions: 1582 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12363686 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -