BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32097 (516 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435334-1|ABD92649.1| 135|Apis mellifera OBP17 protein. 21 5.7 DQ435331-1|ABD92646.1| 135|Apis mellifera OBP14 protein. 21 5.7 DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. 21 10.0 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 21 10.0 >DQ435334-1|ABD92649.1| 135|Apis mellifera OBP17 protein. Length = 135 Score = 21.4 bits (43), Expect = 5.7 Identities = 8/42 (19%), Positives = 21/42 (50%) Frame = +1 Query: 391 DDSEVAEVTKDCMDPEDDDXMIPYAAFLKXVMAWKTSQLVIS 516 +D+E ++ +C D + +I + L+ +KT +++ Sbjct: 93 NDNEADQLLAECSPISDPNALIKISKILECFFKYKTINQILN 134 >DQ435331-1|ABD92646.1| 135|Apis mellifera OBP14 protein. Length = 135 Score = 21.4 bits (43), Expect = 5.7 Identities = 8/40 (20%), Positives = 21/40 (52%) Frame = +1 Query: 391 DDSEVAEVTKDCMDPEDDDXMIPYAAFLKXVMAWKTSQLV 510 D++ V ++ DC +++ + + ++ V +KT + V Sbjct: 93 DENSVKQLVSDCSTISEENPHLKASKLVQCVSKYKTMKSV 132 >DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. Length = 135 Score = 20.6 bits (41), Expect = 10.0 Identities = 9/36 (25%), Positives = 17/36 (47%) Frame = +1 Query: 391 DDSEVAEVTKDCMDPEDDDXMIPYAAFLKXVMAWKT 498 DD+E ++ +C D + I + + M +KT Sbjct: 93 DDNETDQLIVECSPISDANVHIKISKIFQCFMKYKT 128 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 20.6 bits (41), Expect = 10.0 Identities = 8/28 (28%), Positives = 13/28 (46%) Frame = +1 Query: 430 DPEDDDXMIPYAAFLKXVMAWKTSQLVI 513 DP D IPYA + + + L++ Sbjct: 132 DPSDSTMAIPYAVTKSAMFFFAATSLLV 159 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 115,411 Number of Sequences: 438 Number of extensions: 1821 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14354847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -