BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32095 (404 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38727| Best HMM Match : 7tm_1 (HMM E-Value=9.2e-30) 29 1.9 SB_23706| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 28 3.3 >SB_38727| Best HMM Match : 7tm_1 (HMM E-Value=9.2e-30) Length = 420 Score = 28.7 bits (61), Expect = 1.9 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +2 Query: 2 VFLAICLSLTVALAAETGKYTPFQYNRVYSTVSPFVYKP 118 VFL +S+TV + + GKY P YN + ++ F + P Sbjct: 132 VFLVWGISITVGVLSVVGKYEPLAYN--VTVIALFFFLP 168 >SB_23706| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 1021 Score = 27.9 bits (59), Expect = 3.3 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 Query: 74 YNRVYSTVSPFVYKPGRYVADPXRYDPSRDN 166 YNR+ + P++ +PGR DP P RD+ Sbjct: 670 YNRLQARDDPYIKQPGR--DDPYNKQPGRDD 698 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,419,717 Number of Sequences: 59808 Number of extensions: 128833 Number of successful extensions: 351 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 321 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 351 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 727815563 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -