BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32088 (516 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC22E12.04 |ccs1|pccs, pccs|metallochaperone Ccs1 |Schizosacch... 26 3.8 SPAC2F3.01 ||SPAC323.09|mannosyltransferase complex subunit |Sch... 25 8.9 >SPAC22E12.04 |ccs1|pccs, pccs|metallochaperone Ccs1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 297 Score = 25.8 bits (54), Expect = 3.8 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = +1 Query: 43 ACCHHGRSHKCRHERPSKCRHGGKLGC 123 +CC + C E+PS C +G C Sbjct: 270 SCCSQEKKSCCTSEKPSCCSNGKSTVC 296 >SPAC2F3.01 ||SPAC323.09|mannosyltransferase complex subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 319 Score = 24.6 bits (51), Expect = 8.9 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = -3 Query: 337 IISGNSRERYXQRVTVGPEHFTSARVFIIVAQPPKTVV 224 ++ GN + VT H T A+VFI + + K+V+ Sbjct: 243 LLYGNGPNSFFSHVTGDSWHGTDAKVFIWIDRNSKSVL 280 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,755,634 Number of Sequences: 5004 Number of extensions: 30698 Number of successful extensions: 76 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 75 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 76 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 208287218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -