BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV32086 (516 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z74475-6|CAA98961.1| 299|Caenorhabditis elegans Hypothetical pr... 29 2.6 Z73905-2|CAA98109.3| 529|Caenorhabditis elegans Hypothetical pr... 29 2.6 AL023811-2|CAA19423.1| 299|Caenorhabditis elegans Hypothetical ... 29 2.6 >Z74475-6|CAA98961.1| 299|Caenorhabditis elegans Hypothetical protein C51F7.2 protein. Length = 299 Score = 28.7 bits (61), Expect = 2.6 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = +1 Query: 67 AYSKQT-NKQIFPLYNISIDYRNS*MAISLVRNTAFALDLKSLRL 198 +Y+ QT N +YN+ I + MAIS++ NT + L++L + Sbjct: 163 SYTLQTPNMPFIEIYNVLIPFMCICMAISILSNTTSVIFLRNLNI 207 >Z73905-2|CAA98109.3| 529|Caenorhabditis elegans Hypothetical protein C32C4.1 protein. Length = 529 Score = 28.7 bits (61), Expect = 2.6 Identities = 17/57 (29%), Positives = 31/57 (54%), Gaps = 2/57 (3%) Frame = +1 Query: 235 ILIRII-LIQHPHAFL*NNFFTSI-AFEHTLLSRLTNLNFLSNNCYR*VIFFLAISY 399 +++R++ +++ F + TS+ F HTL S +T L+ LS ++FF I Y Sbjct: 360 LVVRVLRVLRMARVFKLARYSTSLQTFGHTLQSSITELSMLSMFLITGIVFFSTIMY 416 >AL023811-2|CAA19423.1| 299|Caenorhabditis elegans Hypothetical protein C51F7.2 protein. Length = 299 Score = 28.7 bits (61), Expect = 2.6 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = +1 Query: 67 AYSKQT-NKQIFPLYNISIDYRNS*MAISLVRNTAFALDLKSLRL 198 +Y+ QT N +YN+ I + MAIS++ NT + L++L + Sbjct: 163 SYTLQTPNMPFIEIYNVLIPFMCICMAISILSNTTSVIFLRNLNI 207 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,078,237 Number of Sequences: 27780 Number of extensions: 174493 Number of successful extensions: 358 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 351 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 358 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 996506972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -