SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= epV32083
         (516 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EU019712-1|ABU25224.1|  535|Tribolium castaneum chitin deacetyla...    21   8.6  
DQ855498-1|ABH88185.1|  127|Tribolium castaneum chemosensory pro...    21   8.6  
AM292364-1|CAL23176.2|  353|Tribolium castaneum gustatory recept...    21   8.6  
AJ973445-1|CAJ01492.1|  127|Tribolium castaneum hypothetical pro...    21   8.6  

>EU019712-1|ABU25224.1|  535|Tribolium castaneum chitin deacetylase
           2A protein.
          Length = 535

 Score = 20.6 bits (41), Expect = 8.6
 Identities = 10/36 (27%), Positives = 16/36 (44%)
 Frame = +3

Query: 45  DHRCSSRPCGYRHRCPPTEDYPKIVRSEFDASPDGA 152
           D  C +RP     R     D   +VR + ++  +GA
Sbjct: 31  DELCENRPADEYFRLTTEGDCRDVVRCDKNSDNNGA 66


>DQ855498-1|ABH88185.1|  127|Tribolium castaneum chemosensory
           protein 12 protein.
          Length = 127

 Score = 20.6 bits (41), Expect = 8.6
 Identities = 6/12 (50%), Positives = 8/12 (66%)
 Frame = -3

Query: 481 IKLITSNKRMWW 446
           I+ +  NKR WW
Sbjct: 88  IRYLIKNKRDWW 99


>AM292364-1|CAL23176.2|  353|Tribolium castaneum gustatory receptor
           candidate 43 protein.
          Length = 353

 Score = 20.6 bits (41), Expect = 8.6
 Identities = 9/24 (37%), Positives = 12/24 (50%)
 Frame = +2

Query: 419 LIQDCVAKHPPHSLVTRY*FDAHC 490
           ++ DCV K    SLV  Y    +C
Sbjct: 272 ILCDCVVKEAQKSLVLTYEMRWYC 295


>AJ973445-1|CAJ01492.1|  127|Tribolium castaneum hypothetical
           protein protein.
          Length = 127

 Score = 20.6 bits (41), Expect = 8.6
 Identities = 6/12 (50%), Positives = 8/12 (66%)
 Frame = -3

Query: 481 IKLITSNKRMWW 446
           I+ +  NKR WW
Sbjct: 88  IRYLIKNKRDWW 99


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 107,106
Number of Sequences: 336
Number of extensions: 1994
Number of successful extensions: 4
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 122,585
effective HSP length: 53
effective length of database: 104,777
effective search space used: 12363686
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -